ECF proteins of ECF subgroup ECF293s6

Displaying ECF 1 - 20 of 118 in total
Name Aliases LCA Taxa Group Subgroup
ECFp100076
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Bergeyella zoohelcum ATCC 43767 ECF293 ECF293s6

>ECFp100076 ECF293 ECF293s6 Bergeyella zoohelcum ATCC 43767

1 MKGKYAIIEEWIDAYSAPLLRRALYMVSDKEEAEDMVQEVFTASFIAFDS
51 FQNKSNPLTWLYAILHNKVADFYRKKYKNPIENNLSHFFDSNGNWKDESI
101 IQPWEDTPEEWEQSLHECIEKLPPRWKIPVKLYYLKEKKNEVVCQEVGIT
151 PTNLWKILQRSRLQLRECLENNRFVG

>ECFp91370 ECF293 ECF293s6 Chryseobacterium glaciei

1 MTKNETLKNWIEQYSEPLLKRAVYVLSDRIEAEDIVQEVFIAAFSSYDSF
51 EGKSKPLTWLNTILNNKVADFYRKKYKSEPEIRLDHFFDETGSWKNNDVL
101 NDWDASNKESELLDNDDFNKTLEDCLEDLPSRWKIPMKMYYLQEKKAPEV
151 SQELNISTTNLWKILQRSRMQLRECLDFNWFAKS

>ECFp115823 ECF293 ECF293s6 Elizabethkingia anophelis

1 MHATKQLEEWIDLYGQKLFDRAFYLLSSREDAEDIVQEVYVAAYSAMDNF
51 QEKSSPLTWLMGILQHKVTDLYRKKYKGNPQISLDHFFDNHEFWKDPDGI
101 LKNWDTSDASLLDNEVFNAYLEKCLEELPDRWLTLVKLTYLQEKKSTEIC
151 QETNISTTNYWKILQRSRLQLRECLQFNWFGKEK

>ECFp99719 ECF293 ECF293s6 Prevotella

1 MKQENEELNKWIELYSEPLLNRALSMVRDKEDAMDLVQEVFISAAAAHGS
51 FERRSSPLTWLQHILKNKTADFYRDRYRKPDCVSLPEFFDKSGAWTDDTV
101 LHDWSQSFDEPDEQNALTGVLNKCLGFLPPQWQTTVRLYYLEEKKTKEVC
151 QELDIATTNLWKILQRSRMQLRKCIELNWFDKL

>ECFp98849 ECF293 ECF293s6 Chryseobacterium indologenes

1 MKNETLKNWINQYSGPLLKKAVYLLSDKEDAHDVVQEVFLAAYSAYDSFE
51 GKSQPLTWLMGILNRKVADFYRKKYKSEPHVRLDHFFDETGSWKSNDVLK
101 NWDASDTGDELLDNTDFNKTLEECIEELPARWKILLKMYYIEEKKAPEVS
151 QELNVSTTNLWKILQRTRMQLRECLEFNWFSRV

Name Aliases LCA Taxa Group Subgroup
ECFp98810
  • Sigma-70 region 2
  • RpoE family DNA-directed RNA polymerase sigma subunit
  • ... more
Prevotella buccae ATCC 33574 ECF293 ECF293s6

>ECFp98810 ECF293 ECF293s6 Prevotella buccae ATCC 33574

1 MTQEHEEINTWIERYSEPLLNRALSTMRNKEDAMDVVQEVFIAAAAAYHT
51 FEGKSTPLTWLLHILKNKTADFYRDKYRKPEVVNMPEFFDRTGAWTDDSV
101 LHEWSRGIEEGEDRHALMNTLDNCIDHLPSQWKVTVKLYYIEEKKANEVC
151 QELNIATTNLWKILQRSRMQLRKCIEVNWFEKL

>ECFp98056 ECF293 ECF293s6 Bergeyella zoohelcum CCUG 30536

1 MKDKYAIIEEWIDAYSASLLHRALYMVSDKEEAEDMVQEVFTASFIAFDS
51 FQNKSNPLTWLYAILHNKVTDFYRKKYKNPIENNLSHFFDSNGNWKDESI
101 IQPWEDTPEEWEQSLHECIEKLPPRWKIPVKLYYLKEKKNEVVCQEVGIT
151 PTNLWKILQRSRLQLRECLENNRFVG

>ECFp96425 ECF293 ECF293s6 Elizabethkingia anophelis

1 MHATKQLEEWIDLYGQKLFDRAFYLLSSREDAEDIVQEVYVAAYSVMDNF
51 QEKSSPLTWLMGILQHKVTDLYRKKYKGNPQISLDHFFDNHEFWKDPDGI
101 LKNWDTSDASLLDNEVFNAYLEKCLEELPDRWLTLVKLTYLQEKKSTEIC
151 QETNISTTNYWKILQRSRLQLRECLQFNWFGKEK

Name Aliases LCA Taxa Group Subgroup
ECFp94722
  • RNA polymerase sigma factor
  • IQ37_19190
  • ... more
Chryseobacterium piperi ECF293 ECF293s6

>ECFp94722 ECF293 ECF293s6 Chryseobacterium piperi

1 MMKKNEELKSWVNKYSESLLKRAMYLLSDKDDAKDVVQEVFLSAFSSYDT
51 FEGKSNPLTWLTSILNRKVADFYRKKYKSEPHIKLDHFFDEKGSWRNDGV
101 LNDWDVSLKETELLDDQDFNKTLEDCIEELPSRWKIPLKMYYLQEKKAPD
151 VSQELNISTTNLWKILQRSRMQLRECLDFNWFAKS

>ECFp94266 ECF293 ECF293s6 Chryseobacterium sp. OV705

1 MMKNEVLKNWIEQYSEPLLKKAFYLLSDKEEAQDIVQDVFIAAFSSYNSF
51 GGKSQPLTWLMAILKRKVADFYRKKYRSEPNIRLDHFFDETGSWKNNDVL
101 NDWNAAGKESELLDDQDFNKTLEECMEELPSRWKILLKMYYIEEKKAPEV
151 SQEFNVSTTNLWKILQRSRMQLRECLEFNWFSRL

>ECFp94151 ECF293 ECF293s6 Chryseobacterium sp. StRB126

1 MMKNEILKSWIEQYSGPLLKKALYLLSNKEDAQDVVQDVFIAAFSSYDSF
51 EGKSQPLTWLMAILNRKIADFYRKKYKSEPRVKLDHFFDETGSWKNNDVL
101 NDWNVSTESELLDNPDFNKTLEECIEELPARWKILLKMYYIEEKKASDVS
151 QELNVSTTNLWKILQRSRMQLRECLEFNWFSRL

>ECFp93566 ECF293 ECF293s6 Chryseobacterium sp. CBo1

1 MTKNETLKSWIEQYSEALLRRAVYLVSDKVEAEDLVQEVFISAFSSFDSF
51 EGKSKPLTWLMTILSYKVADFYRKKYKSEPEIKLDHFFEENGSWRNNDVL
101 NNWNTENREAELLDDRDFNQALENCLEDLPSRWKIPVKMYYLEEKKAPEV
151 SQELNISTTNLWKILQRSRMQLRECLEFNWFAKS

>ECFp93012 ECF293 ECF293s6 Elizabethkingia

1 MHATKQLEEWIDLYGQKLFDRAFYLLSSREDAEDIVQEVYVAAYSAMDNF
51 QEKSSPITWLMGILQHKVTDLYRKKYKGNPQVSLDHFFDNHEFWKDPDGI
101 LKNWDTNDASLLDNEAFNAYLKKCLEELPDRWLTLVKLTYLQEKKSTEIC
151 QETNISTTNYWKILQRSRLQLRECLQFNWFGKGK

>ECFp92523 ECF293 ECF293s6 Elizabethkingia meningoseptica

1 MDNTKELEKWIDQYGQKLFDRALYLLSSQEDAKDLVQEVYIAAFSAMPHF
51 QEKSAPLTWLMGILHHKVSDFYRKKYKGEPQVSLDHFFNEDHFWKDADGI
101 LKKWNTDDSSLLDNEAFNAYLEKCLEELPERWLTLVKLTYLQEKKSSEIC
151 QETNISTTNYWKILQRSRLQLRECLQFNWFGKGK

>ECFp92515 ECF293 ECF293s6 Prevotella

1 MTQEHEEINTWIERYSEPLLNRALSTMRNKEDAMDVVQEVFIAAAAAYHT
51 FEGKSTPLTWLLHILKNKTADFYRDKYRKPEVVNMPEFFDRTGAWTDDSV
101 LHEWSRGIEEGEDRHALMNTLDKCIDHLPSQWKVTVKLYYMEEKKANEVC
151 QELNIATTNLWKILQRSRMQLRKCIEVNWFEKL

Name Aliases LCA Taxa Group Subgroup
ECFp92459
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Tannerella forsythia ECF293 ECF293s6

>ECFp92459 ECF293 ECF293s6 Tannerella forsythia

1 MNLKDRELNKWIERYSRPLLERARYLLSDKEDAMDMVQEVFITAHSAYHT
51 FQGKSDPLTWLYNILRNKTADFYRKKYKAPSTISLSHFFDETGFWKDGNV
101 LNYWNDDTDHLTDNTEFNDTLENCIDRLPPKWKLLVKLYYLQEKKAIEIC
151 QEIGLTTTNLWKVLQRSRLQLRECLERNWFEQ

>ECFp91891 ECF293 ECF293s6 Chryseobacterium

1 MTKNEALKNWIEQYSESLLRRAIFLLSDTIEAEDIVQEVFIAAFSSYDSF
51 EGKSTPKTWLNTILNNKVADFYRKKYKSEPQIKLDHFFDETGSWKNDTVL
101 NDWNVSNPEAELLDNQDFNKSLEDCIEDLPSRWKIPMKLYYLEEKKAPEV
151 SQELDISTTNLWKILQRTRMQLRECLEINWFSKS

>ECFp91780 ECF293 ECF293s6 Porphyromonas gulae

1 MKVENKEINEWVELYSKPLLNQALSMVADKDDAMDLVQEVFVSASSAYHT
51 FERKSAPLTWLQHILKNKIADFYRDRYRKPQTVSMSDFFDQSGSWTDHSV
101 LSEWSLVSEDLDAQRALIDALEKCIEHLPAQWQITVKRYYINEKKANEVC
151 RELDIATTNLWKILQRSRMQLRKCIELNWFDQL

>ECFp91052 ECF293 ECF293s6 Capnocytophaga ochracea

1 MLNMKSSTEEVAQWVDAYTEKLLDHACYLVSDRVEAEDLVQEVFLTALSS
51 YDSFQNRSNPLTWLKAILRHKIADFYKKKYKSPHVNFDYFFDEDGNWKKN
101 QEIDEWEEDTSSLENLLDDIDFRETLQNCLNKLPTKWSILMKMCYLEGKK
151 SSEICQVMNITQTNYWKMLQRSRMQLKECLEINWFKE

>ECFp90875 ECF293 ECF293s6 Elizabethkingia

1 MHATKQLEEWIDLYGQKLFDRAFYLLSSREDAEDIVQEVYVAAYSAMDNF
51 QEKSSPITWLMGILQHKVTDLYRKKYKGNPHVSLDHFFDNHEFWKDPDGI
101 LKNWDTNDTSLLDNEAFNAYLKKCLEELPDRWLTLVKLTYLQEKKSTEIC
151 QETNISTTNYWKILQRSRLQLRECLQFNWFGKGK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more