ECF proteins of ECF subgroup ECF293s29

Displaying all 13 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp99637
  • RNA polymerase sigma24 factor
  • N540_RS0103810
Solirubrobacterales bacterium URHD0059 ECF293 ECF293s29

>ECFp99637 ECF293 ECF293s29 Solirubrobacterales bacterium URHD0059

1 MPAVAEPPELLERLRAGDEAAFAGLVDAHTPSMLRVARGFVPSAAVAEEV
51 VQETWLGVLRGLDRFEGRSSLRTWIFTILVNRARTRGERERRTVPFATLA
101 AAEAGEGFNAVDPARFLPADHDRWPHHWAAPPARWDEVPEDAVAHAETLA
151 LVRRAIDGLAPAQRTVIMLRDMIGCDAEEVCSALGITDANQRVLLHRARS
201 RVRAALEEHLA

>ECFp90938 ECF293 ECF293s29 Actinoplanes subtropicus

1 MADTALPADAVVVARLRARDETMFAALIDAWSPAMLRAARAYVADEHTAQ
51 DVVQEAWLGVLRGIDGFQEASSLRTWVYRILINKAKTRGVRDARTVPGLG
101 VTDDDHGPTVDPARFRGADDPYPGHWRSSPPAWPSPEDGALAAETRRQLA
151 DALAGLPARQRVVVTLRDVAGHSSDEVCELLSISAANQRVLLHRGRAALR
201 AVLEQHWVKEATA

>ECFp90620 ECF293 ECF293s29 Arthrobacter sp. ERGS1:01

1 MVPSGLGPSASACPETDLLMVGRLLAGDQGAFAEVVSAYSPLMLHVARGF
51 VSTRASAEDVVQEAWLGVCRGLDGFQGRSSLRTWVLAITRNVGRRRGVAD
101 ARELAWSQIDDDGDGTVDPARFRGPADPWCGGWTEAGAPVPWSPEQLALD
151 GEALALVTSYLRELPERQRTVVTLRDVDGLDVGQVCEILGISAGNQRVLL
201 HRGRARLRGLLEDYYNRGEVRR

Name Aliases LCA Taxa Group Subgroup
ECFp89998
  • hypothetical protein
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Chondromyces crocatus ECF293 ECF293s29

>ECFp89998 ECF293 ECF293s29 Chondromyces crocatus

1 MALVARLVAGDEACFTQLVERLHGPMQRLARTLVRDQAGAQEIVQETWTV
51 VLDSLPRFEGRASLKTWIFRILTNRARTRATRDKRMVPVAWMEDGGADDE
101 SAVSPERFHWWGRWTSAPTSFPSASPEDHVLRKEMGTRLLVELDALPQGQ
151 RAVVTLRDVDGCSSEEVCEILGINETNQRVLLHRGRARLRAALEQYLRSE

Name Aliases LCA Taxa Group Subgroup
ECFp38556
  • RNA polymerase sigma24 factor
  • G569_RS0106310
Solirubrobacter soli DSM 22325 ECF293 ECF293s29

>ECFp38556 ECF293 ECF293s29 Solirubrobacter soli DSM 22325

1 MSTPVSVDPDAELLARLRCGEELAFRTLVERYSATMLRVARLHVRDRQAA
51 EEVVQETWLAVIKGLERFEERSTLKTWLFRILSNRAKSRGEREARTVPFS
101 ALVAADIGGDEPAVDPDRFRGPEDQYPGGWAAPPPRWETLPQERLLSRET
151 LERVDAAIEGLPPAQRAVIRLRDVDGWDSDEVCELLGLSHGNQRVLLHRA
201 RSKVRAALERYLGDEVTSA

>ECFp33622 ECF293 ECF293s29 Acidobacteria

1 MPERSARARQRIDNPAHPDDAALVERLLAGDEAAFSGLVTQYHGRLLRLA
51 LLFVSDRASAEEVVQDTWLAVLTGLRSFEGRSGLKTWIFSILTNRAKTRG
101 QRDKRSVPFSALSHDPGEGDRAVSPSRFTEAGSWSAPPEQWDADTPERLL
151 LRRETRALIDRTIAGLPPGQRAVVTLRDVEGLDSTEACNILEISETNQRV
201 LLHRARARIRTALEQHVQKR

>ECFp163432 ECF293 ECF293s29 Mycobacteroides abscessus subsp. abscessus

1 MRVARAYVSDHPTAEDVVQETWIAVVKGIRGFEGRSSLKTWLFAVLTNIA
51 KQRGVRDHRRNETLTDFGAATVDPARFHRPGEPGAGSWKQPPAPFPDSPE
101 GSVLHRELLEVARRELDKLPEGQRAVVTLRDLLGFDAAEVCEVLDITAGN
151 QRVLLHRGRAAIRQSLEDYLSAGQREF

>ECFp162619 ECF293 ECF293s29 Mycobacteroides abscessus subsp. abscessus

1 MQETWIAVVKGIRGFEGRSSLKTWLFAVLTNIAKQRGVRDHRRNETLTDF
51 GAATVDPARFHRPGEPGAGSWKQPPAPFPDSPEGSVLHRELLEVARRELD
101 KLPEGQRAVVTLRDLLGFDAAEVCEVLDITAGNQRVLLHRGRAAIRQSLE
151 DYLSAGQREF

>ECFp149627 ECF293 ECF293s29 Deltaproteobacteria bacterium CG2_30_63_29

1 MTRLALSFVKTQASAQEVVQETWVGVLSGLKRFEGRSSLKTWIFRILINR
51 AKTRGVREARTVPFSALGDGDEAEPAVEPERFRANGGWAEPPHRWEDDTP
101 EALLLRGEARQRLEQAITELPPRQRTVLVLRDLEGVSAEEVCNIMGIAET
151 NQRVMLHRARSVLHRALESYLDEE

>ECFp34838 ECF293 ECF293s29 Deltaproteobacteria bacterium RBG_16_71_12

1 MEDAAEPTGGGDAGLPSHGASDADRALVAKLRARDATAFSELLERYHGPL
51 LRLAMAFVPSRAVAEEVVQETWLGVLDGLDRFEGRSSLKTWIFRILTNRA
101 KARGVREKRTVPFSALADDGGDHEPAVDAARFQQDGMWGVPPRRWEDDTP
151 EKLLMTAQAIERLEGAIAALPPNQRAVVTLRDVDGLDADEVCNVLEITET
201 NQRVLLHRARSRLRAVLEDLVDRR

>ECFp114210 ECF293 ECF293s29 Mycobacteroides

1 MQEPVGAASLADQLRNGDPEAFSKLLDLYGSSMQRVARGYVSSRELAEDV
51 VQETWIAVFRGIDKFEGRASLRTWIFTILINVAKKHGLAERRHTDTAVRV
101 MTGGTVDPDRFRDAGDPLPGHWKEPPAPFPDTPEGSLLSGELTRVATAAL
151 RQLPTRQREVVTLRDVQGFTSEEVCQMLDISAVNQRVLLHRGRAVVRQEL
201 ENYLGTMA

>ECFp109270 ECF293 ECF293s29 Actinoplanes subtropicus

1 MVDAVLPADAVVVARLRARDETMFAALIDAWSPGMVRAARAFVADDHTAQ
51 DVVQEAWLGVLRGIDGFQERSSLRTWVYRIVVNKAKTRGVRDARTVPASS
101 LGLDDGPTVDPARFRGADDPYPGHWRSFPPAWPSPEDDAVAGETRRQLAA
151 ALAGLPDRQRVVVTLRDVSGHSSEEVCEMLSISAANQRVLLHRGRAALRA
201 TLEQHWIKEAMA

Name Aliases LCA Taxa Group Subgroup
ECFp100767
  • hypothetical protein
  • H958_RS40295
Solirubrobacter sp. URHD0082 ECF293 ECF293s29

>ECFp100767 ECF293 ECF293s29 Solirubrobacter sp. URHD0082

1 MTRFAGEGGQYDATEECVQEAWLGVIRGLDGFEGRSRLRTWAVGIVVNIA
51 RRRAQRDGRVVPWTALEDDSGPTVDPHRFRVAGERWAGGWTEQGAPRAWE
101 PEAALLSGEAMDVLASGLAELPPRQRAVVTLRDVHGLTPEEVCGVLDLTL
151 GNQRVLLHRGRARLRQLLEDYHRPDVEATRT

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more