ECF proteins of ECF subgroup ECF293s16

Displaying ECF 1 - 20 of 31 in total
Name Aliases LCA Taxa Group Subgroup
ECFp163619
  • RNA polymerase subunit sigma-24
  • BOX37_22825
Nocardia soli ECF293 ECF293s16

>ECFp163619 ECF293 ECF293s16 Nocardia soli

1 MPADDELVERLRDGDDSAFAVILGAWSGSMLRLAMSFVSTPASAEEVVQD
51 TWLAVIRGIDGFEGRSALKTWVFRILVNTAKKRGIKEHRTVPFGSLLPED
101 SGPTVDPDRFRPADDPHPGHWRPGEKPRRWSEPEDAAERVELGNVLAAAI
151 AQLPARSRVVLTLRDAEGYTCEEVCALLEITPGNQRVILHRARAAVRAQL
201 EPYFRTITGDVTTES

Name Aliases LCA Taxa Group Subgroup
ECFp147106
  • ECF RNA polymerase sigma-E factor
  • NS506_06804
Nocardia seriolae ECF293 ECF293s16

>ECFp147106 ECF293 ECF293s16 Nocardia seriolae

1 MGHDGVLPPDDVLVGNLRQRDESTFGLVLDAWSPGMLRLARSFVSTNASA
51 EEVVQETWLAVIRGIDGFEGRAAFKTWVYRILVNTAKKRGIAESRTVPFA
101 SLLSEDEGPSVDPDRFRPAGDPYPGHWKAGEKPQRWSEPENAAERAEFAQ
151 VVAAALAELPDRHRIVLVLRDMEGYSSEEVCGLLDISAGNQRVILHRARA
201 AIRTKLEGYFDAEAVLS

Name Aliases LCA Taxa Group Subgroup
ECFp96492
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Streptosporangium roseum DSM 43021 ECF293 ECF293s16

>ECFp96492 ECF293 ECF293s16 Streptosporangium roseum DSM 43021

1 MSQMSNQEETIVESFTGGRLPPDDVVVAALRAGDEAMFATLLDTWSRGML
51 WLARTHVSTNDSAEEIVQDTWLAVVRGIGGFEGRSSVKTWVYRILVNTAK
101 KRGMRENRTVPWSSVFEQERPTVDRSRFQGVDDPLPGHWKELPAAWPTPE
151 GEVLAAEVRGRIAAALAELPPRQRAVITLRDVEGCTSEEVCEILEISAAN
201 QRVLLHRARASVRGQLEDYFETARRSA

Name Aliases LCA Taxa Group Subgroup
ECFp95556
  • RNA polymerase subunit sigma-24
  • IO39_RS08820
Nonomuraea candida ECF293 ECF293s16

>ECFp95556 ECF293 ECF293s16 Nonomuraea candida

1 MTRRSTGGGAIVGSFAGGALPPDDVVVSALRAGDEAMFAALLDTWSRGML
51 RVARSYVSTDHSAEEVVQDTWLAVIDGIDAFEQRSSVKTWVFRILVNTAK
101 KRGVRESRTLPWSTFEQDGEPGQGSFRGRGRGPGQGPGGPADPVAAWPTP
151 EGEALAGEVRALIAEALARLPPRQRVVISLRDVEGCTSDEVCEILEISPA
201 NQRVLLHRARTAVRGLLASYYESVTQPE

>ECFp94708 ECF293 ECF293s16 Streptomyces sp. RSD-27

1 MAGPRELPSDDVLVQRLRAGDEETFALVLDSWSGGMLRLAMSFVSTKDSA
51 EEAVQDTWLAVIRGIDNFEGRASLKTWVYRILVNTAKARGTKESRTVPFA
101 SLLPEEEGPTVDAERFRAPGEQYAGHWVAGQEPRPWHIPEDHVLRGEVRE
151 LIAEAIDELPPRLRTVITLRDVAGYGSEEVCSLLDISPGNQRVLLHRGRA
201 LLRRKLESYLFGAQGVAGGRGRA

>ECFp93679 ECF293 ECF293s16 Herbidospora

1 MSEGVVRLGGVTDFPPDPVIVAGLRSGDEEVFALLLDEWSRGMLRLARSY
51 VSTAASAEEVVQDTWLAVIRAVGTFEGRSSLRTWVYRILVNTARRRGERE
101 SRTIPVSSVGGERPDGVPPERAEGGPEGAALAGEVRELIDKAVGTLPSRQ
151 RAVITLRDMEGYGSDEVCEILSISPANQRVLLHRARAAVRDHLAAYYDGK
201 GGP

>ECFp92888 ECF293 ECF293s16 Herbidospora mongoliensis

1 MSEGVVRVGEVTDFPPDPVIVAGLRSGDEEVFALLLDEWSRGMLRLARSY
51 VSTAASAEEVVQDTWLAVIRAVGTFEGRSSLRTWVYRILVNTARRRGERE
101 SRTIPVSSVGGERPDGARPEGGPEGAALAGEVRALIEKVVGTLPSRQRAV
151 ITLRDMEGYGSDEVCEILSISPANQRVLLHRARAAVRDHLAAYYDGIGGP

Name Aliases LCA Taxa Group Subgroup
ECFp90615
Nocardia seriolae ECF293 ECF293s16

>ECFp90615 ECF293 ECF293s16 Nocardia seriolae

1 MTVCCVERGVRVGHDGVLPPDDVLVGNLRQRDESTFGLVLDAWSPGMLRL
51 ARSFVSTNASAEEVVQETWLAVIRGIDGFEGRAAFKTWVYRILVNTAKKR
101 GIAESRTVPFASLLSEDEGPSVDPDRFRPAGDPYPGHWKAGEKPQRWSEP
151 ENAAERAEFAQVVAAALAELPDRHRIVLVLRDMEGYSSEEVCGLLDISAG
201 NQRVILHRARAAIRTKLEGYFDAEAVLS

>ECFp90059 ECF293 ECF293s16 Nocardia concava NBRC 100430

1 MSHNGVLPPDDVLVGNLRKRDEAAFQSMLDAWSPGMLRLARSFVSTNASA
51 EEVVQEAWLAVIRGIDGFEGRSAFKTWVYRILVNTAKKRGIAESRTVPFA
101 SLLGEDEGPSVDPDRFRPAGDPYPGHWKAGQKPQHWSEPETATERAEFAR
151 VVAGALAELPDRHRIVLVLRDMEGYSSEEVCGLLDISAGNQRVILHRARA
201 AIRTKLEGFFDADLLGGPEGAVLS

>ECFp86147 ECF293 ECF293s16 Herbidospora daliensis

1 MSEGVVRLGGVTDFPPDPVIVAGLRSGDEEVFALLLDEWSRGMLRLARSY
51 VSTAASAEEVVQDTWLAVIRAVGTFEGRSSLRTWVYRILVNTARRRGERE
101 SRTIPVSSVGGERPDGVPPGEGGPEGAALAGEVRELIDKAVGTLPSRQRA
151 VITLRDMEGYGADEVCEILSISPANQRVLLHRARSAVRDHLAAYYDGKGG
201 P

Name Aliases LCA Taxa Group Subgroup
ECFp81340
  • hypothetical protein
  • A3G7_RS0132520
Nonomuraea coxensis DSM 45129 ECF293 ECF293s16

>ECFp81340 ECF293 ECF293s16 Nonomuraea coxensis DSM 45129

1 MASFAGGALPPDHVIVTALRAGDEAMFAALLDTWSRGMLRVARSYVSTDD
51 SAEEVVQDTWLAVIGAIDDFEGRSSVRTWVYRILVNAAKKRGLRESRTLP
101 WSALESDGGRGVDPSRFHGVDAGLPGSWKVPPAAWPTPENQALAAEARGI
151 IAEALAELPPRQRIVITLRDVEGCTSEEVCDILDISPANQRVLLHRARSV
201 VRDRLEGYFRSVMAAE

Name Aliases LCA Taxa Group Subgroup
ECFp79430
  • RNA polymerase subunit sigma-24
  • IG94_RS0134410
Streptomyces ECF293 ECF293s16

>ECFp79430 ECF293 ECF293s16 Streptomyces

1 MAGAHELPPDEVLVQRLRSGDEEAFALVLDTWSGGMLRLASSFVSTKASA
51 EEAVQDTWLAVIKGIGDFEGRSSLKTWVYRILVRTAKTRGTKESRTVPFT
101 SLLPEEAEATVDASRFRSPGERYAGHWAVGQEPRPWHLPEDHVLRGEVRE
151 LIAEALDDLPPRLRAVLTLRDVEGYGSQEVCSLLEISPGNQRVLLHRARA
201 MLRSRLDAYASSPDDAHAGGGERGLR

Name Aliases LCA Taxa Group Subgroup
ECFp92404
  • RNA polymerase sigma24 factor
  • G514_RS0101565
Nocardioides halotolerans DSM 19273 ECF293 ECF293s16

>ECFp92404 ECF293 ECF293s16 Nocardioides halotolerans DSM 19273

1 MAGDAGELVAALRAGDEAAFARIVQDWSRPMLTLARGFVSTQASAEEVVQ
51 ETWLAVLKGIDRFEGRSSLRTWVFRILVNTAKSRGVKEHRTLPWSSIAGD
101 EAGPGLDPALFQSAGEPYPGHWRAAPSAWPEEVAVEGSVLAGEVRRELAS
151 VLETLPDRQRIVLTLRDVLGHSSEEVCELLGISQANQRVLLHRARTAARA
201 GIAAYVEGS

>ECFp166521 ECF293 ECF293s16 Nonomuraea jiangxiensis

1 MGSFAGGGLPPDDVVVTALRAGDEAMFATLLDTWSGGMLRVARSYVSTDH
51 SAEEVVQDTWLAVIGGIDGFEGRSSVKTWVYRILVNTAKKRGVRESRTLP
101 WSAFEQDGVPVTEFGTGDGWKEAAAVWPSPEGEALASEVRRLIAEALGRL
151 PPRQRIVITLRDVEGCTSDEVCEILEISAANQRVLLHRARTTVRGRLAGY
201 FESVKQPE

>ECFp166106 ECF293 ECF293s16 Sinosporangium album

1 MGTYLGEPPPDDVVVEALRAGDETVFAQLLDLWTPGMLRLARSYLSTRDS
51 AEEVVQDTWLAVIGNIDGFQRRSSVKTWVYRILINTAKKRQARESRTIPW
101 SSAFNGDQPEGAATDPSRFRRGTDLRSGGWKELPALWPTPEGEALAAEAR
151 DRLATALAGLPPRQRTVITLRDVEGHTSEEVCEILEISAANQRVLLHRAR
201 ASVRGVMEDYFEAASRSI

>ECFp164580 ECF293 ECF293s16 Actinobacteria bacterium 13_2_20CM_2_71_6

1 MRRVRGVSDRSLPPDAVVVDRLRAGDEATFAALLDAWSPGMLRAARAYVA
51 DEHTAEDVVQEAWVGVLKGIHGFAARSSLRTWVYRILINTAKTRGVRDSR
101 TIPLTSLTPVDEDFGPTVNPDRFQGAGDPYPRHWRSDPPAWPTPENEAVT
151 TETRRQLADALAALPPRQRVVITLRDVQGYTTDEVCAILEISPANQRVLL
201 HRARAAVRAALEEYLTTWTSA

Name Aliases LCA Taxa Group Subgroup
ECFp163970
Nonomuraea maritima ECF293 ECF293s16

>ECFp163970 ECF293 ECF293s16 Nonomuraea maritima

1 MVVGSIAGDVLPPDDVVVTALRAGDETMFATLLDTWSHGMLRVARSYVST
51 DHSAEEVVQDTWLAVIDGIDGFEGRSSVKTWVYRILVNTAKKRGLRESRT
101 LPWSAFERDGQPSGGHGPPMTGRAEFTAAWPTPEGEALAAEARGLIAEAL
151 SRLPLRQRVVITLRDVEGCTSDEVCDILEISAANQRVLLHRARTAVRGWL
201 AGYYESVKQPD

>ECFp96867 ECF293 ECF293s16 Streptomyces sp. DSM 15324

1 MAGVLELPPDEVLVQRLREGDERAFALVLDSWSGGMLRVAMAFVSTRESA
51 EEAVQDTWLAVIKGIGDFEGRSSLKTWVYRILVNTAKARGTKESRTVPFG
101 DLLAEEEGPTVDPARFRGRGEPYAGHWAVGQEPRPWHFPEGHVLRGEVRG
151 VIEKAIDGLPPRLRTVITLRDVEGYGSEEVCSLLEISPGNQRVLLHRARA
201 LLRGKLERYLSGTHEVAVGRGQA

>ECFp163254 ECF293 ECF293s16 Actinobacteria bacterium 13_1_20CM_3_71_11

1 MLASDEELVGRLRGGDGTAFAALLDAWSHGMLRAARGYVASEEAAEDVVQ
51 ETWLAVIRGIDRFEGRSSLRTWAYRILVNIAKTHGVKDSRTVAWSSLGPE
101 DQGPTVDPDRFRGPDDPYPGHWRRFPDPWPPPSPESEVVSREVRSLVEAA
151 VAGLPHRQRVVITLRDIDGYTSEEVCAILGVSAANQRVLLHRARAAVRGR
201 LEQYFTAEGVRR

>ECFp161894 ECF293 ECF293s16 Thermostaphylospora chromogena

1 MGLPPDDVIVAALRAGDEAMFATLLDTWSRGMLRVARTYVSTSHSAEEVV
51 QDTWLAVIGGIDGFEGRSSLKTWVYRILVNTARRRGERESRTVPWSSAFE
101 PGDGRSAAPAKDADDTLPGVWKAYAETWSAPEGEVLVSEIRDQIWAALAA
151 LPLRQRSVIVLRDVEGCTSEEVCEILDISPANQRVLLHRARVAVRERLKG
201 YFETARRSV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more