ECF proteins of ECF subgroup ECF293s14

Displaying ECF 1 - 20 of 40 in total
Name Aliases LCA Taxa Group Subgroup
ECFp87117
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Sphingobacterium sp. 21 ECF293 ECF293s14

>ECFp87117 ECF293 ECF293s14 Sphingobacterium sp. 21

1 MLTNDPEINTIDNHAVNPHKWVSRYADYLYTYAAFRINDEDLARDLVQET
51 FLSALERKEKFEGKSSEKTWLTAILKNKIVDVYRSRSMRLAKGVDATNSD
101 DTDTDFFDHNDGHWKEQHRPAELGIEQADALENKEFQKILEACMKKLPAL
151 WFSVFSMKHIDDETTEMICSELKLTSSNFWVIIHRTKVNLRSCLQKNWI

Name Aliases LCA Taxa Group Subgroup
ECFp99798
  • RNA polymerase subunit sigma-24
  • N180_13960
  • ... more
Pedobacter antarcticus ECF293 ECF293s14

>ECFp99798 ECF293 ECF293s14 Pedobacter antarcticus

1 MPTNTKAPELTDVGPSLWVSNYADYLYRYAYTRIDDNEHARDLVQETFLA
51 ALESWERFDGRSSEKTWLTAILKNKIFDVYRKKSTALNKQSISLNGLDND
101 EFFESNGHWKKEHYPESFGIEEPLELENKEFDSILKACMKKLPPLWKSVF
151 SMKHIDEETSETICAQLNLTTSNFWVISHRAKVSLRECLQRNWI

>ECFp99704 ECF293 ECF293s14 Pedobacter sp. Leaf176

1 MLITDSGNNTTDNSAVNPHHWVSRYADYLYTYAVLRINDDDLSRDLVQET
51 FLAALEQMQNFKGISTEKTWLTAILKNKIMDVYRSRSKGLVKGVKSINPD
101 GIDTGFFDDDTGHWNDQHRPANMGIEQADAVENKEFQQILTACMNKLPDL
151 WRAVFSMKHIDDESTEMICSELKLSSSNFWVIVHRSKINLRSCLQKNWI

Name Aliases LCA Taxa Group Subgroup
ECFp89978
  • hypothetical protein
  • ACM46_02950
  • ... more
Chryseobacterium angstadtii ECF293 ECF293s14

>ECFp89978 ECF293 ECF293s14 Chryseobacterium angstadtii

1 MKKEDSGLNPEQWVDAFADFLYRFAIMRVNSKEDAEDMVQETFLAAYKNI
51 EKFENRSSVKTWLTSILKNKIVDYYRKKGNSNQSYDEYLGQTEASFENTF
101 FNEANYGRWKQNINKNYISESADEYILSKEFYKIMDFCLQKMPFKLKSVF
151 VAKYMLDEDAEKICKEFDITSSNYWVLLFRAKTLLRSCLEKNEITL

>ECFp88405 ECF293 ECF293s14 Chryseobacterium glaciei

1 MEKNDYLNPEQWVDEFSDFLFAFAVKRVNCREDAEDIIQETFLSAYKGLK
51 QFEGKASVKTWLTSILKNKIIDYYRQKSNSKGYDDYFSETEESFGNAFFN
101 ENNYGRWKPKIHKNYISENADQYILSKEFHEILEYCLQKLPPKLKPVFIA
151 KYMMDDDAKKICKELNITSSNYWVLLFRSKTLLRSCLEKKEIKPYV

Name Aliases LCA Taxa Group Subgroup
ECFp88036
  • RNA polymerase subunit sigma-24
  • AQF98_08560
  • ... more
Pedobacter sp. Hv1 ECF293 ECF293s14

>ECFp88036 ECF293 ECF293s14 Pedobacter sp. Hv1

1 MQDAKPATVEMVNPRQWIENYADYLYRYALTRINDEEQARDLVQETFLAG
51 LEKTATFEGKSSEKTWLTAILKNKIIDLYRKKSSGLSAKTEALTEETFQQ
101 DFFDAEDGHWKQEHRPKEFIALQEEPLQQKEFNNILQGCMKKLPELWYAI
151 FSMKHIDEEPTEVICTTLKVTPSNFWVIIHRTKLSLRACLQKHWI

>ECFp84993 ECF293 ECF293s14 Flavobacterium sp. MEB061

1 MHGSDRRFDIEEKKKLDPSNWVEKYADYLYSYAAVKLYDDELARDLVQET
51 FLAALEAQKGFNGLSSEKTWLTAILKYKIADIYRSRSSGLRNNAQRAAPE
101 QEEDFFDHDNGHWNSGHDPVDFFCEQPDILQDNEFQAILQACMKKLPALW
151 LSVFTMKHVDEEPSESICKAMGLSSSNFWVIIHRAKVNLRSCLQKNWI

Name Aliases LCA Taxa Group Subgroup
ECFp84901
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Mucilaginibacter paludis DSM 18603 ECF293 ECF293s14

>ECFp84901 ECF293 ECF293s14 Mucilaginibacter paludis DSM 18603

1 MAADKQFLNPRLWVETHAEYLYGYTLSRLNDEELAKDLVQETFLAALRSA
51 GKFEGKSSERTWLTAILKNKIVDVYRKKSSGLKNTDVKQAEEEQENFFDE
101 DNGHWNKAYQPKPFGIEDHDPLAGKEFNSILQKCMQKLPALWMAVFTMKH
151 IDDATADMICSELKVTQANFWVIIHRAKLNLRACLQKNWV

Name Aliases LCA Taxa Group Subgroup
ECFp83886
Pedobacter sp. V48 ECF293 ECF293s14

>ECFp83886 ECF293 ECF293s14 Pedobacter sp. V48

1 MQIAQNEAPSLENRTLHPQSWVSKHADYLYSYALARINDEEQARDMVQET
51 FLAALEKADKFEGRSSERTWLTAILKFKVIDLYRKNASGFAKSTEQGTPE
101 GDQDFFDADDGHWNNQHRPKEFGIEQSDALENKEFQRILQLCMKKLPSLW
151 LSVFTMKHMDDEATETICSELKVSASNFWVIIHRTKVSLRSCLQKNWI

>ECFp81821 ECF293 ECF293s14 Chryseobacterium sp. CCH4-E10

1 MRNTDSGLAPEQWVDAFADFLYSFAITRVNSREDAEDIVQDTFLAAFKNA
51 DKFEERASVKTWLTSILKNKIVDYYRKKSHSSQSYEDYLDETEASFENAF
101 FNHDNYGRWKNDIHKNYLSESTDDYILSKEFYKILEFCLQKLPSKLKPVF
151 VAKYMLDEDAEKICKDFNITSSNYWVLLFRAKTLLRSCLEKNEITL

Name Aliases LCA Taxa Group Subgroup
ECFp81303
  • hypothetical protein
  • B156_RS0105945
Spirosoma luteum DSM 19990 ECF293 ECF293s14

>ECFp81303 ECF293 ECF293s14 Spirosoma luteum DSM 19990

1 MHSRKSSGFTSTHIIDPHKWVVRYADYLYNYALKRINNEDSARDLVQETL
51 LAALERMDKFEARSSEITWLTAILKNKISDVYRKKSAASPDMIDISELDP
101 LFSQQDGHWIIRHRPVEFEMEPEEPAQHPEFMEILQNCMKKLPNLWFAVF
151 TMKHMDEKKTEAICHELSITPANFWVIIHRAKVNLRACLQKNMQ

>ECFp77013 ECF293 ECF293s14 Pedobacter cryoconitis

1 MSIPDSEETLTTAPVILDPQHWVANHADYLFSYAITRINEEEQAQDLVQE
51 TFLAALQRIHKFEGRSSERTWLTAILKNKVIDVYRKKSSGLGKNITSLDT
101 EQQDQDFFDPYDGHWKKSHCPEPFGIDTNDPLMNKELKSILQKCIQKLPA
151 LWLSVFTMKHMDEESTELICEELRVTPSNFWVIIHRAKLNLRACLQKNWI

Name Aliases LCA Taxa Group Subgroup
ECFp88652
  • RNA polymerase subunit sigma-24
  • I57_RS09670
Cytophagales bacterium B6 ECF293 ECF293s14

>ECFp88652 ECF293 ECF293s14 Cytophagales bacterium B6

1 MITESNVLNPHQWVSQYADYLYLYAMMRINNEDTAKDLVQETFLAALEKV
51 DKFEGKSTERTWLTAILKNKIIDVYRKRASGLTVNSAYEAEQETDDFFDE
101 DTGHWKAKYAPQQIATIDGQDALLKKEFNGILQMCLAKLPHLWRSVFTMK
151 HLDDAAAAVICSELRVTQANFWVIIHRAKVSLRACLQKNWN

>ECFp169270 ECF293 ECF293s14 Mucilaginibacter lappiensis

1 MSNNNDITTNVLTEPGKWVAQYADYLYTYAYTRINDEDLAKDLVQETFLA
51 ALEKLDQFKGNSSERTWLTAILKNKVIDVYRKKSSAFAKKTDVVEAEQEQ
101 QDFFDHDDGHWNVEHRPKAFGIEEQDPLTNKEFNYILQKCLQKLPALWLS
151 VFTMKHMDDQTTDVICEELRVSPSNFWVIIHRTKLNLRACLQKNWI

>ECFp168407 ECF293 ECF293s14 Mucilaginibacter sp. NFR10

1 MLTETNVLNPHKWVAAYADYLYMYAIVRINDEDTAKDLVQETFLAALEKV
51 DRFEGKSTERTWLTAILKNKIIDVYRKKSSGLAIASANKAAQEQDDFFEE
101 DNGHWKAEYAPQPIAAMDDQDPLLKKELNGILQKCLQKLPALWNAVFTMK
151 HIDDAATENICTELHVSQANFWVIIHRAKVNLRACLQKNWN

Name Aliases LCA Taxa Group Subgroup
ECFp167647
Chitinophaga sancti ECF293 ECF293s14

>ECFp167647 ECF293 ECF293s14 Chitinophaga sancti

1 MLDGSVAQNHLAPENWVRLHADFLYNYAINRLNSDELARELVQETFLAAL
51 ERSANFRGESTERTWLTAILKHKIIDIYRSRAARFPATDKWGTPSNEPEW
101 FDPDLNNWKKEHWPAPFSVKDDDLLDNKEFMKVLQACLSKLPPLWMSVFK
151 LKHMEDEQTATICKHMRLTTANFWVIIHRAKVNLRSCLQKNWI

>ECFp167325 ECF293 ECF293s14 Mucilaginibacter pineti

1 MASENQRPDPRQWVMAHADYLYNYALSRLNNEEQAKDLVQETFLAALEKV
51 DKFEGKSSERTWLTAILKNKVIDVYRKKSSGLRPTEDVKEAEHDQQDFFD
101 AEDGHWNVNNRPKAFGVENCDPLVDKEFNHILQRCMQKLPALWMAVFTMK
151 HIDDATTDIICTELKVTQANFWVIIHRAKLNLRACLQKNWI

>ECFp166949 ECF293 ECF293s14 Mucilaginibacter polytrichastri

1 MAKYADYLYSYAVTRINDGELARDLVQETFLAALEKAAKFEGRSSESTWL
51 TAILKNKIIDIYRKKSSGLLKRQEVPVEVSESDDFFEVDDGHWKVQHQPQ
101 AFGLEVYNPLIGKEFDHILKQCMQKLPVLWLSVFTMKHMDEETTETICSE
151 LRVTPANYWVIIHRAKVNLRACLQKNWI

>ECFp166213 ECF293 ECF293s14 Mucilaginibacter lappiensis

1 MVTEKQLLDPHHWVKAHADYLYSYTLSRLNDEEQAKDLVQETFLAALEKV
51 DRFEGKSSERTWLTAILKNKIIDVYRKKSSGLANIAEQKAEEEQKDFFEE
101 DNGHWTQAHQPLPFGIEDHEPLRGKEFNHILQLCMQKLPAMWMSVFTMKH
151 MDEATTEFICSELRVTQANFWVIIHRAKLSLRACLQKNWI

>ECFp96981 ECF293 ECF293s14 Pedobacter sp. PACM 27299

1 MQSNELVSMPAPSEVLNPRKWASNYADYLYSYAITRINDQEQARDLVQET
51 FLAALESLSRFEGKSTEKTWLTAILKNKIIDLYRKKSTGLSSKTEVLEEE
101 QEQKDFFDEKDGHWNQAHRPQEFASPIETDLQHKEFEHILQACMKKLPNL
151 WYAVFSMKHLEEESTEMICSSLKVTPANFWVIIHRSKLNLRACLQKHWI

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more