ECF proteins of ECF subgroup ECF293s13

Displaying ECF 1 - 20 of 50 in total
Name Aliases LCA Taxa Group Subgroup
ECFp77395
  • ECF subfamily RNA polymerase sigma-24 factor
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Anaeromyxobacter sp. Fw109-5 ECF293 ECF293s13

>ECFp77395 ECF293 ECF293s13 Anaeromyxobacter sp. Fw109-5

1 MEPPRAAGAVGLAGEAEELAALRAGDERAFLALVNRHHAAMVRVAASYVR
51 SRAVAEEVVQETWVGVLGGLHLFEGRSSLKSWIFSILVNRAKARGLKEAR
101 SVPLSSLASDEEDAPAVSPDRFRGEEDRWAGHWAEPPEPWPDARVESSEL
151 VALVAEALETLPPSQRTVMSLRDVDGWEASEVCELMGISEVNQRVLLHRA
201 RSKVRAYVEERLGREGAP

Name Aliases LCA Taxa Group Subgroup
ECFp40993
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • Anae109_1554
Anaeromyxobacter sp. Fw109-5 ECF293 ECF293s13

>ECFp40993 ECF293 ECF293s13 Anaeromyxobacter sp. Fw109-5

1 MRSATDAGGAGEGHVNGLGDSELVALVRTGDRTAFGALVRRHGGALLRFA
51 RVFVRASSVAEEVVQETWMAVLEGLDGFEGRASFKTWLYRILANQARTRA
101 SREGRSIPFSALAETGGDDRAVDPDRFDAAGMWRDPPVGWTDETPERLAL
151 EAETRGVMESAVAGLPPAQRAVLVLRDEDGLETEEICNLLGLTVTNQRVL
201 LHRARTRVRQAIEAHMRGER

Name Aliases LCA Taxa Group Subgroup
ECFp99488
  • hypothetical protein
  • N552_RS0102540
Geodermatophilaceae bacterium URHB0062 ECF293 ECF293s13

>ECFp99488 ECF293 ECF293s13 Geodermatophilaceae bacterium URHB0062

1 MEGGHAAQVELLDRLRAGDRTAFAELVDAWSPMLLRVARLHVSTHASAEE
51 VVQETWLAVIRQLDRFEGRSSLRTWVFRILENQARTRGVREARTVPWSFG
101 SGADGHEHAGATVDRARFRGPEDRWPGGWTPEGRPTAWEPAPEDAAMAAE
151 VRRELRAALDELPERQRTVVELRDVYGLSSDETCERLGLSPGNQRILLHR
201 GRARLRARLEHVYRGTTGEGARRG

>ECFp91225 ECF293 ECF293s13 Anaeromyxobacter sp. PSR-1

1 MNGAATRAIDSPTPGLHDEWGLVAALRLGDEAAFLALVKRYHGAMVRIAR
51 MYLRSDATAEDAVQEAWLGVLKGIDDFEGRASVKSWIFRITAYCAKGRSV
101 REGRFVPLSSLEEDGDDGPAVAPERFQPEGARYANNWSQPPQPWADERLA
151 AVETAALARAEIERLPVRQRTVMTLRDVEGLDSDEVCAILGISEGNQRVL
201 LHRARSKVRAALEQHLEKGGRP

>ECFp88927 ECF293 ECF293s13 Amycolatopsis keratiniphila

1 MACRTRQSVIEVDLEALRRGDDIAFLELVNAYHPTLLRLALVYSPSREVA
51 EEAVQETWIAVLRALDGFEGRSTLRTWICRILINTARRRSAAENRSLPFS
101 SVADGDDTPAVEPERFLRSGPYAGHWASPLHDWSTIPEHTLLAGELQDVV
151 ARAIAALSDNQRVVITLRDVEGWTSDEVCELLGVDAGHQRVILHRARSRV
201 RAALERYLSPEVTGV

Name Aliases LCA Taxa Group Subgroup
ECFp87865
  • hypothetical protein
  • putative RNA polymerase ECF-type sigma factor
  • ... more
Actinobacteria ECF293 ECF293s13

>ECFp87865 ECF293 ECF293s13 Actinobacteria

1 MRHDGALPADDVLVAELRTGVEATFALVVDAWSGSMLRLARSFVSTDASA
51 EEVVQEAWLAVVRGIDRFEGRSSLRTWVYRILVNTAKKRGVKEHRTVPFA
101 SLHPEDEGPTVDPDRFRPPGDPYPGHWAIGRGPRPWSEPEDAAERAELAR
151 CLAAAVAALPDRHRAVLTLRDVEGYAADEVCELLDLSAGNQRVILHRARA
201 AVRAELERYFGR

Name Aliases LCA Taxa Group Subgroup
ECFp87353
  • hypothetical protein
  • IO39_RS41225
Nonomuraea candida ECF293 ECF293s13

>ECFp87353 ECF293 ECF293s13 Nonomuraea candida

1 MDLLALRRGDETAFRELVRDLNPALLRLAVVYSPTRAVAEETVQETWIAV
51 LRGIDGFEGRATLRTWICRILINIARRRAASENRTLPFSSFAADDEDGQP
101 VIPPERFLQSGPYAGHWATPVHDWAEIPESRLLQQEFKGVVAEEVARLPP
151 TQRIVITLRDVEGWSTEEVCELLNIEPGNQRVALHRARHRVRAALERYMS
201 LKTAER

>ECFp81963 ECF293 ECF293s13 Amycolatopsis balhimycina FH 1894

1 MSYPRPVGGITGGRATPLPSDTELLERLRSGDESAYALLLDAWSGKLMRV
51 ARYFVTTNDSARELVQETWLAVLRGITGFEGRSSLKTWVFRILVNAAKRR
101 SAQESRTIPWSSVVQAEDAGPTIDPSRFRGPGDPYPGDWWAYPAAWPTPE
151 QEAMAAEIRNQVASALTELPERQQIVLTLRDVEGHTSEEVCAILEISAAN
201 QRVLLHRARAAVRKRLEDYFAAASPAEDPDAVAP

Name Aliases LCA Taxa Group Subgroup
ECFp79481
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Catenulispora acidiphila DSM 44928 ECF293 ECF293s13

>ECFp79481 ECF293 ECF293s13 Catenulispora acidiphila DSM 44928

1 MEDPSRLPADAELAERLRAGDEDAFRMVLEAWSPSMLRLARSFVSTGDSA
51 EEVVQEAWLGVIQGIERFEGRSALKTWVFRILVNIAKGRGVKESRTLPFS
101 SLLPEDEGPSVDPSRFRSADDPYAGRWSPGQKPQTWALPESEALDGEVRR
151 VVADALDELPERHRTVVILRDVEGYASDEVCRLLNISPGNQRVILHRARA
201 VVRGRLETYFASAERTESADHSPRRNPRKAVRSLARASADSESAGNSPSV
251 SMVRRNCSR

Name Aliases LCA Taxa Group Subgroup
ECFp77823
Sorangium cellulosum ECF293 ECF293s13

>ECFp77823 ECF293 ECF293s13 Sorangium cellulosum

1 MPPTEESDAALVDGLRAGQQGALAELLRRYHRASIRVALTYVGSDALAEE
51 VAQEAWLGIVQGVERFEGRSSFKAWLFCIVANIARRRGRREARTVPFSAL
101 GDGDGDDERGPTVDPSRFQEGGRWDGHWTVPPAGMSDVPDDRLFGLEVRA
151 FIERAIRELPALQQRVIVLRDVEGTSAEEACSILEITEANQRVLLHRARA
201 KVRSAVESLLNEAKE

Name Aliases LCA Taxa Group Subgroup
ECFp44896
  • hypothetical protein
  • H976_RS26295
Marmoricola sp. URHB0036 ECF293 ECF293s13

>ECFp44896 ECF293 ECF293s13 Marmoricola sp. URHB0036

1 MEHEVVRREGAPAYRDPQDDGPGHRDDEHELVDRLRASDEAAFVELVQVH
51 HAAMIRLALTRVRSRAVAEEVVQEAWLGLLRGIETFEQRASLRTWLFRIV
101 LNRAISAGVRERTHLPVGDDELEHRDGRFSRDGWWVTPPAHWADEVVDRV
151 AAPVLAERVHEVIAELPPGQRAVVSLRDVEGLSGAEVCELLDITEGNQRV
201 LLHRARTTIRAALEKEIAL

Name Aliases LCA Taxa Group Subgroup
ECFp43830
  • hypothetical protein
  • N540_RS0102965
Solirubrobacterales bacterium URHD0059 ECF293 ECF293s13

>ECFp43830 ECF293 ECF293s13 Solirubrobacterales bacterium URHD0059

1 MPSSPPADDQSLVERAREGDEDAFAVLVRRYSPMLMRLARMYVPTDALAE
51 DVVQETWVAVLRGLDRFEGRSSFKTWLFRILVNRAKTRGVREHRSIPFAS
101 VGAGEGSEDGEGPTVDPSRFTSEGAWTSAPADWHDDPEASLESEEALRIA
151 RAAIAELPERQRIVITLRDLEGLSSDEVRNVLDVTETNQRVLLHRARAKV
201 RKALEEWIAS

Name Aliases LCA Taxa Group Subgroup
ECFp43126
  • hypothetical protein
  • H958_RS0119945
Solirubrobacter sp. URHD0082 ECF293 ECF293s13

>ECFp43126 ECF293 ECF293s13 Solirubrobacter sp. URHD0082

1 MSDDERELIARLRAGDEDAFMELVERYGPLMLRIAQTYVRSRAVAEDVVQ
51 EAWLGVLNGIDRFEGRSSLKTWILRIVANQARTRGQREGRSVPLSALDGD
101 GDAAVDPDRFFGADQARHPGAWSVPPEPWPEDALLAEETLEQVRMAISQL
151 PPRQQEVIVLRDVEGWDPAEVSEALGLTDGNQRVLLHRARSKVRGELERY
201 LGGVEMAA

>ECFp42392 ECF293 ECF293s13 Chloroflexi bacterium RBG_16_56_8

1 MSTSHQPASTFTRTPLSSEDNSIIQALRAGDECAFESLVTRYHSAMVRLA
51 MIYVGNRETAKDVVQEAWLGVLQGLGRFEGRAALKTWIFSILIHRAKTRG
101 QRENRTIPFSAWSDADPLEPTVDPERFLPSDHPQWARHWSTFPRNWDAIP
151 EEQLLSAETVQVIRQAIDRLEPSQREVITLRDLEGWSSAEVCNVLQIKET
201 NQRVLLHRARAKVRRALESFFDERDLSRPSR

>ECFp41790 ECF293 ECF293s13 Anaeromyxobacter sp. PSR-1

1 MPGQPSPLQPRPEADDAALLERMRQGDRAAFAAVVDRHAGSLLRVARSLL
51 RDAAAAEEVVQETWIALLTGLAGFEGRASVRTWLFRVLVNKARTRFHRDG
101 RTVPFSALGDEDGGASPSADAERFASGGGWAIAPGRWTETDPEQLALGAE
151 TRAAIEAAIRELPDAQRAVLTLRDVEGLETEEICHLLGVTVTNQRVLLHR
201 ARVRIREALAARLGREP

Name Aliases LCA Taxa Group Subgroup
ECFp39047
  • RNA polymerase sigma factor RpoE
  • N177_2323
Lutibaculum baratangense AMV1 ECF293 ECF293s13

>ECFp39047 ECF293 ECF293s13 Lutibaculum baratangense AMV1

1 MRTEAAVSADDSSQDEAEALQRGDEQVFRRLYDAYGSSLIALARTFVRDR
51 ATAEEVVQDTWIAVLTGISRFERRSSLKSWIFSILVNKARTRAKREHRSV
101 PFSAMLVEDADGAVDASRFDRAGMWSDPPHEFDVHDPERVVGGRQMMEHL
151 AAALEDLPPSQRAVVVMRDVEGHDMRETCRILGISEGNQRVLLHRARARL
201 RSRLEQIASDRDARPPGRRERRVTESDAGRLPSDIPVENERR

Name Aliases LCA Taxa Group Subgroup
ECFp37387
  • hypothetical protein
  • OQ00_RS02515
Pseudonocardia autotrophica ECF293 ECF293s13

>ECFp37387 ECF293 ECF293s13 Pseudonocardia autotrophica

1 MSVTVSLDFPLTAEVPDACLVEGLAARDEDAYLVLVRRYTPLMLRVAAAY
51 VRDRAAAEDVVQDTWIAVLRHVGRFEGRSSFKTWLMRILVNIARTRGGRE
101 RRTVPWSSVAADAEWWDEFVTDGADGEPECRLLAAEVAGAIGRALRSLPE
151 RQQIVVTLRDVEGWEAGEVCEALGISPGNQRVLLHRGRVRLRGLLAGRLS

Name Aliases LCA Taxa Group Subgroup
ECFp37101
  • hypothetical protein
  • ANAE109_RS07910
Anaeromyxobacter sp. Fw109-5 ECF293 ECF293s13

>ECFp37101 ECF293 ECF293s13 Anaeromyxobacter sp. Fw109-5

1 MNGLGDSELVALVRTGDRTAFGALVRRHGGALLRFARVFVRASSVAEEVV
51 QETWMAVLEGLDGFEGRASFKTWLYRILANQARTRASREGRSIPFSALAE
101 TGGDDRAVDPDRFDAAGMWRDPPVGWTDETPERLALEAETRGVMESAVAG
151 LPPAQRAVLVLRDEDGLETEEICNLLGLTVTNQRVLLHRARTRVRQAIEA
201 HMRGER

>ECFp36303 ECF293 ECF293s13 Acidobacteria

1 MTFTVNQRADARTETPGAGDRELLERLLAGDEAAFETLVATLHGPMLRFV
51 RTFVSRADVAEEVVQETWLTVLRGLQGFEGRSSLKTWIFHILANRARTRA
101 TRDARVIPFADLLAADDETADAMLESRFTPDGRWSEPPARWQVETPEALL
151 MRGEVMAQLEAALETLPPAQRIVVTLRDVEGLSSEEVCNVLEISETNQRV
201 LLHRGRTRLRRDLADALGR

>ECFp35698 ECF293 ECF293s13 Kouleothrix aurantiaca

1 MAEIEQEPTNSGPPASDDDLQLLAALRAGDEAAFMTLVERYNAPLLRVAM
51 MYVPSRAVAEDVVQETWLGVLQGLARFEGRSSLKTWIFRILTNRAKTRGQ
101 REGRTVPFSDLAVADASAPETSVDADQFWPPDHPSWANIWVSYPRNWNEL
151 PEDRLLSREVMERVRAAIAALPPTQREVITLRDIDGWSSEEVCNILEITE
201 TNQRVLLHRARAKVRKEVDQYLNADTV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more