ECF proteins of ECF subgroup ECF288s3

Displaying all 15 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp85721
  • RNA polymerase subunit sigma-24
  • hypothetical protein
  • ... more
Hungatella hathewayi WAL-18680 ECF288 ECF288s3

>ECFp85721 ECF288 ECF288s3 Hungatella hathewayi WAL-18680

1 MNQQETNRLIDLALDGNAEGLEQLLASVQDMVFNLSLRMLGTVPDAEDAA
51 QDILVRIMTSLSTFRKESSFQTWVYRIATNYLINYKKSMFARQPLDFEFY
101 GNDIKYAAVDETEQLVDEMTRETMAEELKMSCTNVMLQCLDAESRCIFVL
151 GTMFKVDSKIAGEILDMTAENYRQRLSRIRRKVGDFLAEYCGLSGSGCCS
201 CKKRVGYAIAQHRINPERPDFLQLKPVDKGTMSEFKNEMEKLDELSLLFE
251 ELPDYQSPAAVKERISALIQSSQFQAIQSL

>ECFp91704 ECF288 ECF288s3 Erysipelotrichaceae bacterium 3_1_53

1 MQQEEINKRIDQAVQGDRSALEEVLAEIQDMVFNLSLRMLGTIADAQDAT
51 QEILIKVMTSISTFRKESKFQTWVYRIAVNYLMDVRSSMFAQHPLDFDFY
101 ANDLRASYVPDEEEALTGCTREEAARELKLSCTNVMLQCLKPQDRCIYIL
151 GTMFHIDSRSAAEILNMTPEAYRQRLSRARKRMAAFLSEYCGAVSNGFCQ
201 CDKRIPYAVMTHRLQPQNLEYSRMKTLDKRILNEFCNHMEQIEEIMDSFD
251 QLPAFRCTLDAKRLLKELVESDLMKKVQNTKEAA

Name Aliases LCA Taxa Group Subgroup
ECFp98854
  • RNA polymerase subunit sigma-24
  • sigma-70 family RNA polymerase sigma factor
  • ... more
Firmicutes ECF288 ECF288s3

>ECFp98854 ECF288 ECF288s3 Firmicutes

1 MQQEELNKRIDQAVQGDRLALEEVLTEIQDMVFNLSLRMLGTIADAQDAA
51 QEILIKVMTSISTFRKESRFQTWVYRIAVNYLMDVKRSMFAAHPLDFDFY
101 ANDLRASYVPDEEEALTGCTREEAARELKLSCTNVMLQCLKPQDRCIYIL
151 GTMFHIDSKSAAEILDMTPEAYRQRLSRARKRMASFLSTYCGAVSNGFCQ
201 CDKRIPYAVMTHRLEPQNLEYSRLKTLDKRILNEFCDHMEELEEIMDSFD
251 QLPAFRCTMDAKQLLRELVDSEVMKKVQNAKEVA

Name Aliases LCA Taxa Group Subgroup
ECFp163122
  • RNA polymerase subunit sigma-24
  • rpoE_1
  • ... more
Faecalicatena contorta ECF288 ECF288s3

>ECFp163122 ECF288 ECF288s3 Faecalicatena contorta

1 MKEANDNKYALIESAVGGNADALEKLLAGIQDMVFNLSLRMLGTIPDAED
51 AAQEILVRVMTNLGTFRRESDFQTWVYRIAVNYLLNYKKSMFAHQPLDFE
101 FYGNDIKYAVLDETEGLIEEESRQQLAEELKLSCTNVMLQCLDAESRCIF
151 ILGTMFRINSRTAGEILQMSPENFRQRLSRIRGKVAAFLAEYCGLSGVGM
201 CTCRKRVEYAVRQKRISPERLEYLKLHPLENQVLEEYKDEMEKLDELSLV
251 FDELPMYQTPETIKERMLMVMNSSQMKKIQEY

Name Aliases LCA Taxa Group Subgroup
ECFp95953
  • RNA polymerase subunit sigma-24
  • HMPREF0273_RS0106395
Coprobacillus cateniformis ECF288 ECF288s3

>ECFp95953 ECF288 ECF288s3 Coprobacillus cateniformis

1 MTNKELEEIIKLAVEGDKKALEIVISDIQDFVFNLSLRMLGTIADAQDAT
51 QDILIKVITHLSSFHYASQFNTWVYRIATHYLIDYKKSMFAKYPLDFDYY
101 ANDIRAGYIEDHEEIRMGMSQEELAKELKLSCTNVMLQCLDGQTRCVFIL
151 GTMFQIDSRMAAEILDMTPENYRQKLSRARKKMAKFLSENCGLSETGCCD
201 CQKRVCYAIESHRLDPKNLEYQKLPRLEQSLLEDYMDSMMVFEDKMPVFE
251 ELPKYQCPSVVKAFIQDIMNSTHMKKMKQY

Name Aliases LCA Taxa Group Subgroup
ECFp95074
  • RNA polymerase subunit sigma-24
  • T506_RS04695
Blautia schinkii DSM 10518 ECF288 ECF288s3

>ECFp95074 ECF288 ECF288s3 Blautia schinkii DSM 10518

1 MEEQKILELIDAAVGGNSQALEEVLLSVQDFIFNMSLRMLGSVPDAEDAT
51 QEILVRIMTNLASFRRDSKFTTWVYRITVNFLLNYKKSMFAAHPLDFEFY
101 GNDIKYAVLDETDRLVEQLDLEAMSEELKMSCTNVMLQCLDPESRCIFIL
151 GTMFKVDSRAAGEILEMSPENYRQKLSRIRKKVGAFLEEYCGLSGHGMCS
201 CRRRVGYAVSQKRLNPQKLEYSELKTLDNQTLTACREEMERLDEMSLVFE
251 ELPGYQSPDVSRKMLHTLLESQQMKNIQQF

>ECFp85858 ECF288 ECF288s3 Clostridiales bacterium VE202-21

1 MKEANDNKNVLIESAVGGNADALEELLAGIQDMVFNLSLRMLGTIPDAED
51 AAQEILVRVMTNLGTFRRESDFQTWVYRITVNYLLNYKKSMFAHQPLDFE
101 FYGNDIKYAVLDETEGLIEEESRQQMAEELKLSCTNVMLQCLDAESRCIF
151 ILGTMFRINSRTAGEILQMSPENFRQKLSRIRGKVAAFLAEYCGLSGVGM
201 CTCRKRVEYAVRQKRISPERLEYLKLHPLEDKVLEEYKDEMEKLDELSLV
251 FDELPMYQTPETIKERMVMVLNSSQMKKIQEY

>ECFp82828 ECF288 ECF288s3 Erysipelotrichaceae

1 MQQEELNKRIDQAVQGDRLALEEVLTEIQDMVFNLSLRMLGTIADAQDAA
51 QEILIKVMTSISTFRKESRFQTWVYRIAVNYLMDVKRSMFAAHPLDFDFY
101 ANDLRASYVPDEEEALTGCTREEAARELKLSCTNVMLQCLKPQDRCIYIL
151 GTMFHIDSKSAAEILDMTPEAYRQRLSRARKRMASFLSTYCGAVSNGFCQ
201 CDKRIPYAVMTHRLEPQNLEYSRLKTLDKRILNKFCDHMEELEEIMDSFD
251 QLPAFRCTMDAKQLLRELVDSEVMKKVQNAKEVA

>ECFp89097 ECF288 ECF288s3 Clostridiales

1 MNRENNEIMELVDHAVNGDKTSLEMLAAGVQDMVFNLALRMLGTVPDAED
51 ATQEILIRVISNLSSFRKESAFQTWVYRLAVNYLLDYKKSMFAKYPLDFE
101 FYGNDIRYAKTDEIEDLVDELSREAFAEELKMSCTNVMLQCLDAQSRCIF
151 ILGTMFRIDSRTGAEILNMTPENYRQKLSRARKKMADFLAEYCGLTGTGN
201 CSCNRRVDYAIAQRRINPAKLEFGSLEELDGQLIGECKEEMEKLDELAMT
251 FERFPHYRSPVSARKLIENILNSSPFRKIQQY

Name Aliases LCA Taxa Group Subgroup
ECFp166803
Eubacterium sp. SB2 ECF288 ECF288s3

>ECFp166803 ECF288 ECF288s3 Eubacterium sp. SB2

1 MKEANDNKHALIESAVGGNADALEKLLAGIQDMVFNLSLRMLGTIPDAED
51 AAQEILVRVMTNLGTFRRESDFQTWVYRIAVNYLLNYKKSMFAHQPLDFE
101 FYGNDIKYAALDETEGLIEEESRQQLAEELKLSCTNVMLQCLDAESRCIF
151 ILGTMFRINSRTAGEILQMSPENFRQRLSRIRGKVAAFLAEYCGLSGVGM
201 CTCRKRVEYAVRQKRISPERLEYLKLHPLENQVLEEYKDEMEKLDELSLV
251 FDELPMYQTPETIKERMLMVMNSSQMKKIQEY

Name Aliases LCA Taxa Group Subgroup
ECFp148100
  • RNA polymerase subunit sigma-24
  • BN1225_RS03685
Beduini massiliensis ECF288 ECF288s3

>ECFp148100 ECF288 ECF288s3 Beduini massiliensis

1 MMDKNMEKWVAKAIEGDREALEYILIDIRDFVFNLSLRMLGSVADAEDAS
51 QDILVKIMTSLSTFRQESQFKTWVYRIATNYLIDYKKSMFAQHPLDFDFY
101 ANDIRAGFIDTKEELLMGVDKKVLAEELKMSCTNVMLQCLDAPTRCIFIL
151 GTMFGIDSKTAGEILGMTPANYRQKLSRARRKMAAFLSEHCGLSGGYCDC
201 EKRIGYAAKQHRLNPQKLEFKTLKQLDSDVLMRCKASMEEIDELSTVFDE
251 LPKYRSSLEVKQFLEQLLQSKQLKEVQHY

Name Aliases LCA Taxa Group Subgroup
ECFp109793
Clostridium sp. D5 ECF288 ECF288s3

>ECFp109793 ECF288 ECF288s3 Clostridium sp. D5

1 MKEENENKNVLLESAVEGNAEALEKLLGGIQDMVFNLSLRMLGTIPDAED
51 ASQEILVRVMTNLGTFRRESNFHTWVYRIAVNYLLNYKKSMFAHQPLDFE
101 FYGNDIRYAVLDETEGMIEEESRQQLAEELKMSCTNVMLQCLDADSRCIF
151 ILGTMFRIDSRTAGEILQMTPENFRQKLSRIRVKLAAFLAEYCGLSGVGM
201 CSCKKRVEYAVKQKRISPERLEYLKLHPLDSHVLEEYKDEMEKLDELSQV
251 FDELPIYQTPDTVRERMEMVLRSSHMEKIQEY

>ECFp109804 ECF288 ECF288s3 Christensenella sp. AF73-05CM02

1 MDTKTDALVSRALEGDRDALEALLAEVQDTVFNLSLRMLGTPADAEDASQ
51 DILVRVMTNLASFRRESSFSTWVYRIAVNFLIDYKKSMFAHAPLNFDFYG
101 ADIASVQDAPYTGSADAELLAEELKFSCTNVMLQCLSPEDRCIFILGTMF
151 RVDSRIAGEALGISAANYRQKLSRIRKRMSAFLAQYCGLSGTGMCSCKRR
201 AGHAVKQGRIDPEKPAYTALETLDSGLLASCKDEMEAMDDSAAIFASFPA
251 YRSPMSARQFLRELLDSRGMDAIRAF

Name Aliases LCA Taxa Group Subgroup
ECFp100479
  • RNA polymerase subunit sigma-24
  • ACI77_RS08990
Faecalicatena fissicatena ECF288 ECF288s3

>ECFp100479 ECF288 ECF288s3 Faecalicatena fissicatena

1 MKEENENKNVLLESAVEGNAEALEKLLGGIQDMVFNLSLRMLGTIPDAED
51 ASQEILVRVMTNLGTFRRESNFHTWVYRIAVNYLLNYKKSMFAHQPLDFE
101 FYGNDIRYAVLDETEGMIEEESRQQLAEELKMSCTNVMLQCLDADSRCIF
151 ILGTMFRIDSRTAGEILQMTPENFRQKLSRIRVKLAAFLAEYCGLSGVGM
201 CSCKKRVEYAVKQKRISPERLEYLKLHPLDSHVLEEYKDEMEKLDELSQV
251 FDELPMYQTPDTVRGRMEMVLRSSNMEKIQEY

>ECFp108447 ECF288 ECF288s3 Erysipelotrichaceae bacterium I46

1 MQQEELNKRIDQAVQGDRLALEEGLTEIQDMVFNLSLRMLGTIADAQDAA
51 QEILIKVMTSISTFRKESRFQTWVYRIAVNYLMDVKRSMFAAHPLDFDFY
101 ANDLRASYVPDEEEALTGCTREEAARELKLSCTNVMLQCLKPQDRCIYIL
151 GTMFHIDSKSAAEILDMTPEAYRQRLSRARKRMASFLSTYCGAVSNGFCQ
201 CDKRIPYAVMTHRLEPQNLEYSRLKTLDKRILNEFCDHMEELEEIMDSFD
251 QLPAFRCTMDAKQLLRELVDSEVMKKVQNAKEAA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more