ECF proteins of ECF subgroup ECF288s2

Displaying ECF 1 - 20 of 22 in total
Name Aliases LCA Taxa Group Subgroup
ECFp93263
  • RNA polymerase subunit sigma-24
  • sigma-70 family RNA polymerase sigma factor
  • ... more
Lachnospiraceae bacterium 10-1 ECF288 ECF288s2

>ECFp93263 ECF288 ECF288s2 Lachnospiraceae bacterium 10-1

1 MGITMNKKTNEELQALIEEAVTGDKKALELLIADVQDIVFNLSLRMLGTF
51 ADAEDATQDILLKMITHLSSFRGESSFTTWVYSIAANHLKNYKKHMFAQY
101 PLSFEYYGDDIEKGKIQDVPDLTQNVERDILAEELKMSCTNVMLQCLDVE
151 SRCIFILGTMFKIDSRIAGDILGITPEAYRQRLSRVRKKMADFLEQYCGE
201 YGSGRCKCKDRVNYAIQNHRINPLHLDYTTAAEIPDKTMLDVKKAMEDID
251 DLSQDFSFCKPYQSPERTKHLIRELLDSTQLAIIRNL

Name Aliases LCA Taxa Group Subgroup
ECFp98262
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lachnospiraceae bacterium COE1 ECF288 ECF288s2

>ECFp98262 ECF288 ECF288s2 Lachnospiraceae bacterium COE1

1 MDKVTNEELQVLIGRAVAGDKEALGTVLECVQDLVFNLSLRMLGTFPDAE
51 DASQDILLKIVTHLSTFKGESAFSTWVFRIAVNHLKDYKKHMFAKMPLSF
101 AFYGEDIKNAKIDDVPDLTQNVEQSVLAEELKLSCTNVMLQCLDAEERCI
151 FIMGTMFQVDSRIAGEILDITPETYRQRLSRVRRKVADFLSEYCGEYGSG
201 TCKCAQRVNYAIQNHRIAPDRLDFTAATISTQTMLEVKEAMEEIDGLSQQ
251 FSFCKTYQPPKGLKRFIESFLNGEVCAAVTTAVTKA

Name Aliases LCA Taxa Group Subgroup
ECFp106743
  • sigma-70 family RNA polymerase sigma factor
  • C810_03276
Lachnospiraceae bacterium A2 ECF288 ECF288s2

>ECFp106743 ECF288 ECF288s2 Lachnospiraceae bacterium A2

1 MENKRKDNAPCPARKPADSHTAADKPCPELSGYIERAVAGDKESLETVIS
51 SVRDLVFNLSLRMLGTFPDAEDATQDILLKIITHLSSFRKESAFSTWVFR
101 IAVNHLKDYKKHMFANYPLSFEFYGNDIENGKVQDIPDLTQNVEQELLEE
151 ELKMACTNVMLQCLDTESRCIFVLGTMFQVDSRIAGSLLGMTPEAYRQRL
201 SRIRRKVADFLETYCGEYGSGSCRCKNRINYAIQNHRINPACLDYTAAAE
251 LPAGDLYQVKEAMEDIDGLAAKFSFCKTYESPENLKQFVQEFLSSATMSV
301 VKGS

>ECFp83485 ECF288 ECF288s2 Clostridiales bacterium VE202-15

1 MEIKSNEEWTNCIEKAVAGDKEALERIVLNLQDMVFNLSLRMLGTFPDAE
51 DAAQDILLKVITRLATFRGESAFTTWVFRIATNHLIQYKKHMFAQRPLSF
101 EYYGADIENARLEEVPDLTQNVERFILAEELKMSCTNVLLQCLDAESRCI
151 FVLGTMFKLDSRIAGEILDMTPEAYRKRLSRIRGKVADFLSAYCGEYGGG
201 QCRCMKRVDYAIQNHRLNPVALDYTAATEHTPEQRRQFKNAMEEIDDLSA
251 RFSFLKTYQSPERTRQFFREFLTSASLSAVTNA

>ECFp151908 ECF288 ECF288s2 [Clostridium] lavalense

1 MEIKSNEEWTNWIEKAVAGDKEALERIVLNLQDMVFNLSLRMLGTFPDAE
51 DAAQDILLKVITHLATFRGESAFTTWVFRIATNHLIHYKKHMFAQMPLSF
101 EYYGADIENARLDEVPDLTQNVERSILAEELKMSCTNVLLQCLDAESRCI
151 FVLGTMFKLDSRIAGEILDMTPEAYRKRLSRIRRKVADFLSAYCGEYGEG
201 QCRCMKRVDYAIQSHRLNPAALDYTTATEHRPEQMRQFKNAMEEIDDLSA
251 RFAFCKTYQSPERTRQFFREFLASASLSAVTNA

>ECFp147160 ECF288 ECF288s2 uncultured Eubacterium sp.

1 MNIKTNEELSILIDKATSGDEKSLETIILSVQDLVFNLSLRMLGVFPDAE
51 DASQEILLKVITHLSSFKKESSFSTWVFSIASNHLKNYKKSMFVQYPLSF
101 EYYGYDIENGAAEDLPDLTQDIEKSLLAEELKLSCTNVMLQCLDAENRCI
151 FILGTMFKVDSRIAGEILGITPETYRQRLSRVRKKMAEFLENYCGEYGQG
201 KCKCKNRVNYAIQTHRLQPQNLAFTSSKEIVLDVKNAMEEVDDLAGKFDF
251 SKTYAPPETLHQFVKDFLQSTQISTIQGAGLEEM

Name Aliases LCA Taxa Group Subgroup
ECFp94893
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lachnospiraceae bacterium 28-4 ECF288 ECF288s2

>ECFp94893 ECF288 ECF288s2 Lachnospiraceae bacterium 28-4

1 MNSFTNEELLNLIQKATAGDKSSLETVILNIQDLVFNLSLRMLGTFPDAE
51 DASQDILLKVMTHLSSFKGESSFSTWVFRIAVNHLKDYKKHMFAQFPLSF
101 EFYGDDIRNAKTEDIPDLTQNVEQAILAEELKLSCTNVMLQCLDTENRCI
151 FILGTMFKVDSRIAGDILGITPEAYRQRLSRVRKKMADFLTEYCGEYGKG
201 KCHCADRVNYAIQSHRIHPTQLYFQTAVSSEVMLDVKEAMEEIDDLSQEF
251 SFCKTYQSPENLKQFIEEFLNGTSFSIVKNS

Name Aliases LCA Taxa Group Subgroup
ECFp107721
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Eubacterium plexicaudatum ASF492 ECF288 ECF288s2

>ECFp107721 ECF288 ECF288s2 Eubacterium plexicaudatum ASF492

1 MSKKTNEELKILVDQATAGDKKALETLVCDVQDLVFNLSLRMLGTFADAE
51 DAAQDILLKMITHLSSFRGDSSFTTWVFRIAVNHLKNYKKHMFAHRPLSF
101 EYYGDDIENGKIRDVPDLTQNVEKDLLTEELKMSCTNVMLQCLDTESRCI
151 FILGTMFRIDSGIAGEILDMTPQAYRQRLSRVRKKMADFLGQYCGEYGGG
201 KCRCMDRVNYAIQSHRLNPQHPEYTSSVEISAETMLQVKRAMEDIDDLSQ
251 QFLFCKPYRSSERTKYLIRELLDSTQLSVIRNS

Name Aliases LCA Taxa Group Subgroup
ECFp97766
  • hypothetical protein
  • N510_00006
  • ... more
Firmicutes bacterium ASF500 ECF288 ECF288s2

>ECFp97766 ECF288 ECF288s2 Firmicutes bacterium ASF500

1 MNTKENQELSALIGQATAGDRAALETVLTGVQDLVFNLSLRMLGTFHDAE
51 DASQDILLKVMTHLSSFKGDSAFTTWVFRIAANHLKDYKKHMFAQLPLSF
101 EFYGDDIRNGKIQDVPDLTQNVEQTILAEELKLSCTNVMLQCLDPDSRCI
151 FILGTMFRLDSRIAGDILGITPEAYRQRLSRVRKRMAEFLSEYCGEYGQG
201 ACHCANRVNYAIQNHRIAPDRLDFTAAKPSDTAVEVTAAMEEIDGYSQQF
251 SFCRTYQSTERLTRMIRDFLNGPAFSTVAEAQGVEQ

Name Aliases LCA Taxa Group Subgroup
ECFp110785
  • hypothetical protein
  • B132_RS0105900
Clostridiales ECF288 ECF288s2

>ECFp110785 ECF288 ECF288s2 Clostridiales

1 VIIMNIKNNEELTVLIEKATAGHEKSLETIILSVQDLVFNLSLRMLGSFP
51 DAEDATQEILLKLITHLSSFRRESSFTTWVFSIASNHLKNYKKSMFSRHP
101 LSFEFYGYDIEHGKALDIPDPAQDIEKAVLAEELKLSCTNVMLQCLDTES
151 RCIFILGTMFRADSRIAGEILGISPEAYRQRLRRVRKKMADFLEEYCGEY
201 GRGTCRCKNRVSYAIQNHRIDPSKTEYTSYAEIPPDTLMEVKNAMEDIDG
251 LSGSFQFCKAYRTPDHTKRFIQDFLKSTQISTIINNETENV

Name Aliases LCA Taxa Group Subgroup
ECFp93631
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lachnospiraceae bacterium A4 ECF288 ECF288s2

>ECFp93631 ECF288 ECF288s2 Lachnospiraceae bacterium A4

1 MKNKTNEELQALVAKATAGDKKALETLIAGVQDIIFNMSLRMLGTFADAE
51 DATQDILLKMITHLSSFRGDSSFTTWVFRIAANHLKNYKKHMFARYPLNF
101 EYYGNDIENAKIDDVPDLTQNVETDILAEELKLSCTNVMLQCLDEESRCI
151 FILGTMFQIDSRIAAELLELTPEAYRQRLCRVRKKMADFLAQYCGEYGSG
201 RCKCRDRVNYAIQSHRLNPLQLDYVSATEIPIQTMMAVKNAMEDIDNLSQ
251 DFSFCKPYQSPEHTRHLIQEFLDSTQFSTIQNA

Name Aliases LCA Taxa Group Subgroup
ECFp88284
  • RNA polymerase subunit sigma-24
  • C810_RS24725
Lachnospiraceae bacterium A2 ECF288 ECF288s2

>ECFp88284 ECF288 ECF288s2 Lachnospiraceae bacterium A2

1 MSGYIERAVAGDKESLETVISSVRDLVFNLSLRMLGTFPDAEDATQDILL
51 KIITHLSSFRKESAFSTWVFRIAVNHLKDYKKHMFANYPLSFEFYGNDIE
101 NGKVQDIPDLTQNVEQELLEEELKMACTNVMLQCLDTESRCIFVLGTMFQ
151 VDSRIAGSLLGMTPEAYRQRLSRIRRKVADFLETYCGEYGSGSCRCKNRI
201 NYAIQNHRINPACLDYTAAAELPAGDLYQVKEAMEDIDGLAAKFSFCKTY
251 ESPENLKQFVQEFLSSATMSVVKGS

Name Aliases LCA Taxa Group Subgroup
ECFp88263
  • RNA polymerase subunit sigma-24
  • Sigma-70 region 2
  • ... more
[Clostridium] asparagiforme DSM 15981 ECF288 ECF288s2

>ECFp88263 ECF288 ECF288s2 [Clostridium] asparagiforme DSM 15981

1 MEIKSNEEWTNCIEKAVAGDKEALERIVLNLQDMVFNLSLRMLGTFPDAE
51 DAAQDILLKVITRLATFRGESAFTTWVFRIATNHLIQYKKHMFAQRPLSF
101 EYYGADIENARLEEVPDLTQNVERFILAEELKMSCTNVLLQCLDAESRCI
151 FVLGTMFKLDSRIAGEILDMTPEAYRKRLSRIRGKVADFLSAYCGEYGGG
201 QCRCMKRVDYAIQNHRLNPAALDYTAATEHTPEQRRQFKNAMEEIDDLSA
251 RFSFLKTYQSPERTRQFFREFLASASLSAVTNA

Name Aliases LCA Taxa Group Subgroup
ECFp86948
Dorea sp. D27 ECF288 ECF288s2

>ECFp86948 ECF288 ECF288s2 Dorea sp. D27

1 MDDKLQNEMEQLVGRAVAGDKNAVEKILTEIQDLVFNFSLRMLGTIADAE
51 DATQEILIKVMTHLSSFRGESRFTTWVFRIASNYLKDYKKHMFSKYPLSF
101 EFYGEDIEGGKEKDIPDLTQGVEQAILEEELKMSCTNVMLQCLDKESRCV
151 FILGTMFKVDSRIAGDMLGISPEAYRKRLSRVRSKMAEFMGRYCGLEGGM
201 CSCGRRVNYAIASHRLRPDNLEYSAMGQGNDKVMNGFKNAMERVDDLSFV
251 FSDMPFYHGGREVKTWLQGFFDSEEYRTITEA

Name Aliases LCA Taxa Group Subgroup
ECFp85301
Blautia producta ECF288 ECF288s2

>ECFp85301 ECF288 ECF288s2 Blautia producta

1 MNIKSNEELPLLIEKATAGDEKSLETILLSVQDLVFNLSLRMLGSFPDAE
51 DAAQEILLKVITHLSSFRKESSFTTWVFSIASNHLKNYKNSMFARHPLSF
101 EFYGYDIENGSARDIPDLTQDMEKAVLAEELKMSCTNVMLQCLDTESRCI
151 FILGTMFKADSRIAGEILGITPEAYRQRLRRVRRKMADFLEEYCGEYGHG
201 TCRCKDRVSYAIQNHRLNPSRTEYTSSEEIPQETLVDVKNAMEDIDGLAD
251 RFRFCKAYRSPDHAKRFIRDFLRSTQISIVNNSEREEA

Name Aliases LCA Taxa Group Subgroup
ECFp85187
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lachnospiraceae bacterium M18-1 ECF288 ECF288s2

>ECFp85187 ECF288 ECF288s2 Lachnospiraceae bacterium M18-1

1 MHKKTNQEIRALVDQATAGDKEALETLVSGMQDMVFNLSLRMLGTFADAE
51 DATQDILLKMITHLSSFRGDSAFTTWVFRIAANHLKNYKKHMFARYPLSF
101 EYYGDDIENGNIQDVPDLTQNVEKELLAEELKMSCTNVMLQCLDPESRCI
151 FILGTMFQLDSRIAGDILEMSPEAYRQRLSRIRKKMADFLGQYCGEYGGG
201 RCKCKDRVNYAIQNHRINPLQLDYMTAQEIPVQTIRDVKNAMEEIDDLSQ
251 DFSFCKPYQSPERTKNLIQEFLDSTQLSVVQKS

>ECFp77268 ECF288 ECF288s2 Clostridiales bacterium VE202-28

1 MNKNQNVSELIDKAAAGDRESLEALIGSIQDMVFNLSLRMLGTFPDAEDA
51 SQDILLKVMTHLSSFKKESSFSTWVFRIATNHLINYKKHMFAGRPLDFEF
101 YGNDIRCGMPGDLPDLTQDVDKELLAEELKMSCTNVMLQCLDMESRCIFI
151 LGTMFKLDSHTAGTILNMTPEAYRQRLSRIRRKMAGFLTEYCGEYGSGTC
201 HCASRINYAIKSRRLDPQALDYTVAKEINPETAENFKNAMEDIDGLASHF
251 TFCRMYESPERTKQFFSSFLGSAALSFVKNA

Name Aliases LCA Taxa Group Subgroup
ECFp86724
  • RNA polymerase subunit sigma-24
  • Sigma-70 region 2
  • ... more
Clostridiales bacterium 1_7_47FAA ECF288 ECF288s2

>ECFp86724 ECF288 ECF288s2 Clostridiales bacterium 1_7_47FAA

1 MNKNQNVSELIDKAAAGDRESLEALIGSIQDMVFNLSLRMLGTFPDAEDA
51 SQDILLKVMTHLSSFKKESSFSTWVFRIATNHLINYKKHMFAGRPLDFEF
101 YGNDIRCGMPGDLPDLTQDVDKELLAEELKMSCTNVMLQCLDMESRCIFI
151 LGTMFKLDSHTAGAILNMTPEAYRQRLSRIRRKMAGFLTEYCGEYGSGTC
201 HCASRINYAIKSRRLDPQALDYTAAKEINPETAENFKNAMEDIDGLASHF
251 TFCRMYESPERTKQFFSSFLGSAALSFVKNA

Name Aliases LCA Taxa Group Subgroup
ECFp111780
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lachnospiraceae bacterium 3-2 ECF288 ECF288s2

>ECFp111780 ECF288 ECF288s2 Lachnospiraceae bacterium 3-2

1 MKKLTDEEFKALAAKATAGDKKALETLVTNLQDTVFNLSLRMLGTFADAE
51 DAAQDILLKVITHLSSFRGESAFTTWVFRIAVNHLKNYQKHMFAHHPLSF
101 EFYGEDIEHARIEDVPDLSQEIDKELLAEELKMSCTNVMLQCLDAESRCI
151 FILGTMFKIDSRIAGEILNMTPENYRQRLSRTKKKMADFLRQYCGEYGDG
201 RCRCKDRVNYAVSCRRINPLEPDYAKAAEIPLETMLCVKNAMEEMDGLSQ
251 DFSFLKPYESPERTKHFLREILDSAQFSVIKDS

>ECFp110835 ECF288 ECF288s2 Emergencia timonensis

1 MSIKTNEELSILIDKATSGDEKSLETIIASVQDLVFNLSLRMLGVFPDAE
51 DATQEILLKVITHLSSFKKESSFSTWVFSIASNHLKNYKKSMFAQHPLSF
101 EYYGYDIENGAAEDLPDLTQDIEKSLLAEELKLSCTNVMLQCLDAESRCI
151 FILGTMFKVDSRIAGEILGITPEAYRQRLSRVRKKMAEFLENYCGEYGQG
201 KCKCKNRLNYAIQTHRLQPQNLAFTSSKEKEVILDVKNAMEEVDDLAGRF
251 DFCKTYASPETLNKFIKDFLQSTQISTIQSSGMEGM

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more