ECF proteins of ECF subgroup ECF288s1

Displaying ECF 1 - 20 of 37 in total

>ECFp92329 ECF288 ECF288s1 Bariatricus massiliensis

1 MDKSTNKDLTDLIDKAIAGDEKSLETIILSVQDLVFNLSLRMLGTFPDAE
51 DASQEILLKVITHLSSFKKESAFSTWVFRIAANHLKDYKKNMFSQHPLSF
101 EYYGYDIENGGAEDIPDLTQNVEKAILAEELKLSCTNVMLQCLDTESRCI
151 FILGTMFKVDSRIAGEILGITPEAYRQRLVRVRRKMADFLEAYCGEFGGG
201 KCRCKDRLNYAIQSHRLHPAHLEYTSSKEVSTEEITGVKNAMEEIDDLAG
251 RFHFCKTYESPERTRRFIRDFLSSTQISIVNNLGTEGV

>ECFp152754 ECF288 ECF288s1 Bittarella massiliensis

1 MNDLTALEKQTIERAVAGDQKALEEVLAGVQDLVFNLSLRMLGLLPDAED
51 ATQEILIKVMTRLGSFRQESSLTTWVFRIAINHLRDYKKGMFAQRPLSFE
101 VYGEDIASGRERDVPDLGGGVDQGLLERELKLSCTNVMLQCLDAESRCIY
151 VLGTMFRLDSRVAADILGLNPAAYRQRLSRIRKKVGGFLKEYCGLGGGGC
201 SCKRRTNYAIATHRIDPGHLVFPGLEECSYRDIARFTDAMEELDGLSQVF
251 ADLPAYRTPEEVRDWVRGLLASGSFATVMQTEGAKG

>ECFp110536 ECF288 ECF288s1 Clostridioides difficile

1 MSKRTKQELEKLIDRAVLGDKKSLEVLLLDVQDLVFNLSLRMLGTVHDAE
51 DVSQEIMIRVITHLSTFRRECSFSTWVFRIAYNHLQNYKKSMFSKQHLSF
101 EYYGADIKNGRSKDIPDLSQSIESSILEEELKYSCTNVMLQCLDVESRCI
151 FILGTMFKLDSKIASDILGISSDAYRKRLSRIRKKVASFLDEYCGLSGKG
201 VCQCRNRINYAIANHRINPKNLEYSKLEKNDDNILFKFKSAMEETENFST
251 IFSTLPSYYSTGKLKKFVTDFLQSDSYLVIKNS

Name Aliases LCA Taxa Group Subgroup
ECFp77794
  • sigma-70 family RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Clostridiales ECF288 ECF288s1

>ECFp77794 ECF288 ECF288s1 Clostridiales

1 MEKQEKYDMERLVDLAASGNRDALEELLGDVQDMVFNLSLRMLGTVPDAE
51 DACQEILIKVMTHLSDFRKESRFSTWVFRIAVNHVLAYRKHMFSQHPLSF
101 EYYGEDIANGREEDVPDMTGGVDRGILEEELKLSCTNVMLQCLDGESRCI
151 FILGTMFRLDSAVAGEILGISPAAYRKRLSRIREKMAAFLGEYCGLAGGK
201 CSCRRRVDYAIASRRLTPERLEYNGMEQGRSRIAEQCRAIMEEIDGQSRI
251 FAEMPFYRTGPEAKEFIKGLLRSDAYRTVMMS

Name Aliases LCA Taxa Group Subgroup
ECFp149609
Hungatella hathewayi ECF288 ECF288s1

>ECFp149609 ECF288 ECF288s1 Hungatella hathewayi

1 MQEPLYAKSEREEKDMNEKEQMETQKLVRLAAEGDKGALEQLLTGVQDLV
51 FNLSLRMLGTIHDAEDVSQEILIRVMTNLASFRGESAFTTWVFRIAVNHL
101 KNYRKSMFAQHPLSFEYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSC
151 TNVMLQCLDTDSRCIYILGTMFHVDSRLAAEILEISPEAYRQRLSRIKKK
201 MAGFLDEYCGLSGKGVCSCSKRISYAIATHRVNPEKPEYTSLEENTEFLQ
251 ECKTAMEEIDDRSLVFSSLPAYRTTRAARQYLDEFLKSDCYSMISNA

>ECFp110854 ECF288 ECF288s1 Clostridium hathewayi CAG:224

1 MDEKKREDTEMLVSRAVEGDQEALEQLLTEVQDLVFNLSLRMLGTIQDAE
51 DASQEILIRVMTNLASFRRESAFSTWVFRIAVNHLKNYRKSMFARQPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDADSRCI
151 YILGTMFRVDSRLAAEILDLSPEAYRQRLSRIRKKMAGFLEEYCGLSGKG
201 VCSCGKRVSYAIASHRMNPEKPEYTSLKENTEFLLECKTAMEEIDDLSMV
251 FSSLPAYRTTKAAREYLDEFLKSDCYSTISNAL

>ECFp93561 ECF288 ECF288s1 Clostridiales

1 MNNNRTEIAPDAVEKAISGDRKALEELLTGIQDPVFHLSLRMLGSIPDAE
51 DATQEILLKVMTHLSSFRGESAFTTWVFRIAVNHLKDYKKHMFANHPLSF
101 EYYGADIDSGKEKEIPALSPELDHDLLEQELKLSCTNVMLQCLDPESRCI
151 FILGTMFQADSRIAGDILDMTPENYRQKLSRARKKMSAFLKEYCGLTGGK
201 CACKRRIPYAAATHRIHPEAVEYSPLAVPNPDADEFVKQMEEIDDLSLLF
251 SSLPTFRATAEARKFLSDFLSSDRCSYIMNA

Name Aliases LCA Taxa Group Subgroup
ECFp92356
  • Sigma-70 region 2
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Clostridium sp. KLE 1755 ECF288 ECF288s1

>ECFp92356 ECF288 ECF288s1 Clostridium sp. KLE 1755

1 MQNKEPELIDQAVNGDKKALETLLLSVQDMLYNLSLRMLGSPQDAEDAVQ
51 EIMIKIITQLSTFRKESAFSTWAYRVAANYLINCKKSMFAQRPLSFEFYG
101 EDINMGFVPNTEDLLQGVEEEILADELKASCTNVMLQCLDPESRCIYVLG
151 LMFKADSRVCGEILGLTAEAYRQRLSRIRKKVASFLGEYCGLSGTGKCNC
201 RKRVGYAILTHRLNPGNLEYSSQEKLDHYDTAKFTEAMEEMDRLSGVFTQ
251 LPQYRSPLDAKSFLKKLLKSGSMDVIRAEV

>ECFp92062 ECF288 ECF288s1 Clostridium bolteae CAG:59

1 MEKQEKYDMERLVDLAASGNRDALEELLGDVQDMVFNLSLRMLGTVPDAE
51 DACQEILIKVMTHLSDFRKESRFSTWVFRIAVNHVLAYRKHMFSQHPLSF
101 EYYGEDIANGREEDVPDMTGGVDRGILEEELKLSCTNVMLQCLDGESRCI
151 FILGTMFRLDSAVAGEILGISPAAYRKRLSRIREKMAAFLGEYCGLAGGK
201 CSCRRRVDYAIASRRLTPERLEYNGMEQGRSRIAEQCRDIMEEIDGQSRI
251 FAEMPFYRTGPEAKEFIKGLLRSDAYRTVMMS

>ECFp91487 ECF288 ECF288s1 [Clostridium] bolteae 90B8

1 MEKQEKYDMERLVDLAASGNRDALEELLGDVQDMVFNLSLRMLGTVPDAE
51 DACQEILIKVMTHLSDFRKESRFSTWVFRVAVNHVLAYRKHMFSHHPLSF
101 EYYGEDIANGREEDVPDMTGGVDRGILEEELKLSCTNVMLQCLDGESRCI
151 FILGTMFRLDSSVAGEILGISPAAYRKRLSRIREKMAAFLGEYCGLAGGK
201 CSCRRRVDYAIASRRLTPERLEYNGMEQGRSRIAEQCRAIMEEIDGQSRI
251 FAEMPFYRTGPEAKEFIKGLLRSDAYRTVMMS

>ECFp84658 ECF288 ECF288s1 Clostridium

1 MNDLTALEKQTIERAVAGDQKALEEVLAGVQDLVFNLSLRMLGLLPDAED
51 ATQEILIKVMTRLGSFRQESSLTTWVFRIAVNHLRDYKKGMFAQRPLSFE
101 VYGEDIASGRERDVPDLGGGVDQGLLERELKLSCTNVMLQCLDAESRCIY
151 VLGTMFRLDSRVAADILGLNPAAYRQRLSRIRKKVGGFLKEYCGLGGGSC
201 SCKRRTNYAIATHRIDPGHLVFPGLEECSYRDIARFTDAMEELDGLSQVF
251 ADLPAYRTPEEVRDWVKGLLASGSFATVMQAEGAKG

>ECFp84246 ECF288 ECF288s1 Hungatella hathewayi 12489931

1 MQEPSYAKSEREEKDMNEKEQMETQKLVRLAAEGDKGALEQLLTGVQDLV
51 FNLSLRMLGTIHDAEDASQEILIRVMTNLASFRGESAFTTWVFRIAVNHL
101 KNYRKSMFAQHPLSFEYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSC
151 TNVMLQCLDTDSRCIYILGTMFRVDSRLAAEILEISPEAYRQRLSRIKKK
201 MAGFLDEYCGLSGKGVCSCSKRISYAIATHRVNPEKPEFTGLEENTEFLQ
251 ECKTAMEEIDDRSLVFSSLPAYRTTRAARQYLNEFLKSDCYSMISNA

Name Aliases LCA Taxa Group Subgroup
ECFp82753
  • hypothetical protein
  • BN162_RS09615
Holdemania massiliensis AP2 ECF288 ECF288s1

>ECFp82753 ECF288 ECF288s1 Holdemania massiliensis AP2

1 MDKQISEALIEKVLDHQPQAVNELIAQLQTSIFNLALRMLGNIADAEDAT
51 QEILLLVLEKLPAFRGESALTTWVYRVAVNRLIDEKRSMFAQHPLSFEAY
101 AQDIQAYQQESQREDRVILARELKLSCTNVMLQCLKPQDRCIFILGTMFK
151 ADSRQAAEILGLTPENYRQRLSRARRKMADFMSQYCYLASGGCRCTCRID
201 FAIGTQRLDPENLEYSKLPSADPQVLHQHLEAMEKIEDHMTIFDQMEACL
251 LPEEKQRHLQEVVSSVWMEKVCQN

Name Aliases LCA Taxa Group Subgroup
ECFp79477
  • RNA polymerase subunit sigma-24
  • Sigma-70 region 2
  • ... more
Hungatella hathewayi DSM 13479 ECF288 ECF288s1

>ECFp79477 ECF288 ECF288s1 Hungatella hathewayi DSM 13479

1 MDEKKREDTEMLVSRAVEGDQEALEQLLTEVQDLVFNLSLRMLGTIQDAE
51 DASQEILIRVMTNLASFRGESAFSTWVFRIAVNHLKNYRKSMFARQPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDADSRCI
151 YILGTMFRVDSRLAAEILDLSPEAYRQRLSRIRKKMAGFLEEYCGLSGKG
201 VCSCGKRVSYAIASHRVNPEKPEYTSLKENTEFLLECKTAMEEIDDLSMV
251 FSSLPAYRTTKAAREYLDEFLKSDCYSTISNAL

Name Aliases LCA Taxa Group Subgroup
ECFp79090
  • RNA polymerase subunit sigma-24
  • QR40_RS21090
Robinsoniella peoriensis ECF288 ECF288s1

>ECFp79090 ECF288 ECF288s1 Robinsoniella peoriensis

1 MAVSGDRSAMETLLVSIQDLIFNLSLRMLGTIPDAEDAVQEITIRIMTHL
51 ETFRKESSFTTWAFRIAVNHLKNYKKSMFAKRPLSFEFYGYDIKNGAAND
101 IPDPAQNVEQPLLEQELKLSCTNVMLQCLDPDSRCIFILGTMFKADSKIA
151 GEILNITPEAYRQRLSRIRKKMAAFLDEYCELGKQGFCRCRKRIPYAMET
201 HRLNPQNLEYSSLEVLPEELLISCKNAMEQIDDLSLAFSSMPHYRTPENA
251 RTFFMNLLKTDCYAKIENVN

>ECFp77890 ECF288 ECF288s1 Clostridiales bacterium VE202-27

1 MQNKEPELIDQAVNGDKKALETLLLSVQDMLYNLSLRMLGSPQDAEDAVQ
51 EIMIKIITQLSTFRKESAFSTWAYRVAANYLINCKKSMFAQRPLSFEFYG
101 EDINMGFVPNTEDLLQGVEEEILADELKASCTNVMLQCLDPESRCIYVLG
151 LMFKADSRVCGEILGLTAEAYRQRLSRIRKKVAAFLGEYCGLSGTGKCNC
201 QKRVGYAILTHRLNPGNLEYSSQEKLDHYDTAKFTEAMEEMDRLSGVFTQ
251 LPQYRSPLDAKSFLKKLLKSGSMDVIRAEV

>ECFp76881 ECF288 ECF288s1 [Clostridium] clostridioforme 90A7

1 MEKQEKYDMERLVDLAALGNRDALEELLGDVQDMVFNLSLRMLGTVPDAE
51 DACQEILIKVMTHLSDFRKESRFSTWVFRIAVNHVLAYRKHMFSQHPLSF
101 EYYGEDIANGREEDVPDMTGGVDRGILEEELKLSCTNVMLQCLDGESRCI
151 FILGTMFRLDSAVAGEILGISPAAYRKRLSRIREKMAAFLGEYCGLAGGK
201 CSCRRRVDYAIASRRLTPERLEYNGMEQGRSRIAEQCRDIMEEIDGQSRI
251 FAEMPFYRTGPEAKEFIKGLLRSDAYRTVMMS

Name Aliases LCA Taxa Group Subgroup
ECFp106184
  • hypothetical protein
  • DAHG_RS06665
Dielma fastidiosa ECF288 ECF288s1

>ECFp106184 ECF288 ECF288s1 Dielma fastidiosa

1 MDKKNEQELIQAAIQGDSGALEELLLSVRDQIFTLALRMLGSVADAEDAA
51 SEILIKVMCNLSAFRQESAFSTWVYRIAVNTLLTTRKSMFADQPLSFEIM
101 GQDIEAGYIEASQKDTCGVDHEVLADELKLSCTNVMLQCLKPEDRCIFIL
151 GTMFKLDSQNAADILNISAENYRQRLSRSRKKVGDFLKQYCGLVNKDSCS
201 CQKRLGVAIKTHRLNPQHLEYSDHVKIENFIQNMEDLDEISDVYREEVRF
251 CSHLEIKEFLKKLLQSRQLNEVMNEGRETA

>ECFp100848 ECF288 ECF288s1 [Clostridium] bolteae

1 MEKQEKYDMERLVDLAASGNRDALEELLGDVQDMVFNLSLRMLGTVPDAE
51 DACQEILIKVMTHLSDFRKESRFSTWVFRVAVNHVLAYRKHMFSHHPLSF
101 EYYGEDIANGREEDVPDMTGGVDRGILEEELKLSCTNVMLQCLDGESRCI
151 FILGTMFRLDSAVAGEILGISPAAYRKRLSRIREKMAAFLGEYCGLAGGK
201 CSCRRRVDYAIASRRLTPERLEYNGMEQGRSRIAEQCRAIMEEIDGQSRI
251 FAEMPFYRTGPDAGKT

>ECFp168785 ECF288 ECF288s1 Holdemania sp. Marseille-P2844

1 MDNQTQPLSPALIEEVLAHKPQAAAELVRQLQTPIFNLALRMLGSVADAE
51 DATQEILLLVLEKLPCFRGESALSTWVYRLAVNRLIDEKRSMFATHPLSY
101 EAYAQDIQAYQKESQREDKQILARELKYSCTNVMLQCLKPQDRCIFILGT
151 MFKADSRQAAEILNLTPEAYRQRLSRARRKMADFMSQYCYLASGGCRCTC
201 RIDFAIGTRRLDPDNLEYSKLPTAEPQVLQQHLEAMEKIEEHMTVFDTLS
251 AYALPEEKRQKLQEVVASVWMEKVCQN

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more