ECF proteins of ECF subgroup ECF238s18

Displaying all 17 ECF

>ECFp181021 ECF238 ECF238s18 Rhodospirillales bacterium 69-11

1 MSKSRENNDRSDESDELEAAKPADAAVRRALVEARHEFLAFLQQRVGSKA
51 DAEELLQRFSLRALERASQLRDVRSVRGWLGRILATTIVDHQRRAIRKRQ
101 REVSVDPTDFDEIAVEPDRETDEAICNCLHKLLPTMKPDYADILWRSDIL
151 GEPRDRIAASLGTTLNNVTVRLHRARQTLRKRLEEMCLTCPVHGFLDCRC
201 DEAEEIRRRVVASKSTRESS

Name Aliases LCA Taxa Group Subgroup
ECFp26013
Croceicoccus marinus ECF238 ECF238s18

>ECFp26013 ECF238 ECF238s18 Croceicoccus marinus

1 MDDPATSAAAGDDALRPMDEAVRRALVDSHQDILKFLNRRLHSSHEAEEV
51 LQRFMLKAIERAGELREAKSVKGWLSRVLATTIADFQRTVIRRRSKEIGV
101 DPHELAESSHAHTQPEVDLDQTVCNCLYRLLPTLKPDYAEVIWRADLLEE
151 PRDEIAKSLDTTVNNVTVRLHRARRALKTRLLQMCRTCIEHGFLDCECAH
201 AESSLRAHVGGFSAD

>ECFp26054 ECF238 ECF238s18 Bradyrhizobium sp. AT1

1 MKPPNEKLPLPAVGSLGGQDALVRAALVGSYDRLRGYLQRRFGGKGEAEE
51 VLQAFMLRALERSGDVRDADLVRGWLSRVLATTIADFHRKASRNRTREMP
101 FPHELNDRLAADQDAAANTVVCECLYIHLSLLKPEHAEVIRRIDLAGEPR
151 ELVAADLGVTVNNLTVRLHRARHALKERLEQTCVVCLEESFWECRCADNR
201 GPA

Name Aliases LCA Taxa Group Subgroup
ECFp26101
  • DNA-directed RNA polymerase sigma-70 factor
  • WYH_RS12370
Altererythrobacter atlanticus ECF238 ECF238s18

>ECFp26101 ECF238 ECF238s18 Altererythrobacter atlanticus

1 MIENRADKADGSEEALRPMDEAVRRALVDSHEDMLRFLIGRMRGRQEAEE
51 VLQRFMLRAIERAGDLRDVGSVKGWLSRVLATTIADFYRQAARGRKHETA
101 IDPQELAELAEAEVVSDAEMEAAVCNCLYRLLPTLRPDYAEVIWRADLLE
151 EPRESIASALDTSVNNINVRLHRARGALRTRLLQMCRTCVIHGFLDCECQ
201 QEKEQAPAL

>ECFp139749 ECF238 ECF238s18 Bradyrhizobium sp. cf659

1 MKSPNESLPEQTAGPLDVQDAVVRAALVGSYDRLRSYLQRRFGGKAEAEE
51 VLQAFMLRALERSGDIRDADSVRGWLSRVLATTIADFHRQTSKSRTREMP
101 FPHELNERLAADQDPAANAAVCECLHTHLSLLKPEHAEVIRRVDLAGEPR
151 ELVAADLGVTVNNLTVRLHRARHALKERLEQTCVVCLEESFWECRCADNR
201 SPT

Name Aliases LCA Taxa Group Subgroup
ECFp181028
Sphingobium faniae ECF238 ECF238s18

>ECFp181028 ECF238 ECF238s18 Sphingobium faniae

1 MTKSSDATPSAEDAAKPHDAAVQRALVEAQEEILVFLRQRLRNHDEAEEV
51 LQRFSLRVLERAGQLRDVQTVRGWFGRILATTIVDHQRAQARRHRREAAA
101 DSIDIDALPADPDAEIDATVCNCLYRLLPTLKAEYADVIWRADILGEPRD
151 RLAASLGTSLNNVTVRLHRGRKALRMRLEEMCRTCSTHGFLDCRCDEMPL
201 GTDGPVVKTKPVRPPARSRRARKDDA

>ECFp26010 ECF238 ECF238s18 Bradyrhizobium sp. WSM2254

1 MKSPNESLPEQTAGPLDVQDAVVRAALVGSYGRLRSYLQRRFGGKAEAEE
51 VLQAFMLRALERSGDIRDADSVRGWLSRVLATTIADFHRQTSKSRTREMP
101 FPHELNERLAADQDPAANAAVCECLHTHLSLLKPEHADVIRRVDLAGEPR
151 ELVAADLGVTVNNLTVRLHRARHALKERLEQACIVCLEESFWECRCADNG
201 GPT

Name Aliases LCA Taxa Group Subgroup
ECFp26004
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Bradyrhizobium sp. STM 3843 ECF238 ECF238s18

>ECFp26004 ECF238 ECF238s18 Bradyrhizobium sp. STM 3843

1 MKSSNETPEPVAGCSEASDAIVRAALVGSYGRLRSYLQRRFVGQAEADEV
51 LQAFMLRALERSGDIRDADSVRGWLSRVLATTIADHHRQSSKNRIREIPF
101 PNELSDRLAADQDGTVDAAACECLYTHLSLLKAEHAEVIRRLDLAGEPRE
151 QVAADLGVTVNNLTVRLHRARQALRERLEQMCVVCLEDSFWECRCADNRG
201 RTPP

Name Aliases LCA Taxa Group Subgroup
ECFp26052
  • sigH
  • RNA polymerase sigma-70 factor
  • ... more
Erythrobacteraceae ECF238 ECF238s18

>ECFp26052 ECF238 ECF238s18 Erythrobacteraceae

1 MIENKADKADGSEEALRPMDEAVRRALVDSHEDMLRFLIGRMRGRQEAEE
51 VLQRFMLRAIERAGDLRDVGSVKGWLSRVLATTIADFYRQAARGRKHETA
101 IDPQELAELAEAEVVSDAEMEAAVCNCLYRLLPTLRPDYAEVIWRADLLE
151 EPRESIASALDTSVNNINVRLHRARGALRTRLLQMCRTCVIHGFLDCECQ
201 QEKEQAPAL

Name Aliases LCA Taxa Group Subgroup
ECFp26050
  • RNA polymerase sigma-70 factor
  • ECF subfamily RNA polymerase sigma-24 factor
  • ... more
Erythrobacter atlanticus ECF238 ECF238s18

>ECFp26050 ECF238 ECF238s18 Erythrobacter atlanticus

1 MITTLKLLFERINAMKVTASNRDWFQEKAAASGFSAQPTGQCMNDSDNVT
51 TNEPEEALRPMDEAVRRALVEGHEGMLRFLIGRLRNRNDAEEVLQRFMLR
101 AIERANDLRDVKSVKGWLSKVLATTLIDFHRQATRSRMKETVVDPQELAE
151 LAEAEGPSDDDIEAAICNCLYRLLPTLKSEYAEIIWRADLLEEPRESIAE
201 SLDTTVNNINVRLYRARGALKQRLLQMCRTCVIHGFLDCECQHETVDSGA
251 S

Name Aliases LCA Taxa Group Subgroup
ECFp26099
  • RNA polymerase subunit sigma-70
  • G407_RS26875
Salinarimonas rosea DSM 21201 ECF238 ECF238s18

>ECFp26099 ECF238 ECF238s18 Salinarimonas rosea DSM 21201

1 MADDGDDAAEKPPGTAVRRALEDSHGQISSFLRRRLGSAEDAEEVLQAFM
51 LRAVERSHQLEDVASVRGWLSRILATSIADHQRRAARRRGRETSADPHDL
101 ADIPVEADAEIEEAICNCLYTLLPTLKGDYAEVIWRIDLLEERRERVAAD
151 LGLTLNNLAVRLHRGRQALKRRLQEMCLTCPVHGFLDCSCEAAERARRKQ
201 RSGAAADGGPDPINPEHEEKP

Name Aliases LCA Taxa Group Subgroup
ECFp2129
  • RNA polymerase, sigma-24 subunit, RpoE
  • RNA polymerase subunit sigma-70
  • ... more
Chelativorans sp. BNC1 ECF238 ECF238s18

>ECFp2129 ECF238 ECF238s18 Chelativorans sp. BNC1

1 MADDEDQDMPEGAWEGEASKPHDAAVQRALVEAQQTILHFLQNRLRDRDE
51 AEEVLQRFSLRALERAAQLRDVRTVRGWLGRILATTIVDHQRDVIRRRQR
101 EEELGPETLESHEAEPDAELDAAICNCLYRLLPTLKAEYADIIWRADILG
151 EPRDRLAASLGTSLNNVTVRLHRGRRALRKRLEEMCRTCPIHGFLDCHCE
201 KAEKFRVEHAAVAGRAK

Name Aliases LCA Taxa Group Subgroup
ECFp2126
  • RNA polymerase subunit sigma-24
  • RNA polymerase subunit sigma-70
  • ... more
Rhodopseudomonas ECF238 ECF238s18

>ECFp2126 ECF238 ECF238s18 Rhodopseudomonas

1 MSSTRDRGVISANASPLATASDRAVRAALVEGYDRLRNYLQKHFRTPNEA
51 EEVLQTFVLRALERSAAIRDADSVRGWLSRVLATTIADFHRQTSKRRARE
101 VEFAVELYDRLVADQRGELDWAACECVHAYLPLLKTEHSEAIKRIDLGGE
151 QREAVAAELGVTVNNLTVRLHRARQALKERLEGSCAGCGEESFFECRCGD
201 HERNIHSGFELQPNGRNEKRS

Name Aliases LCA Taxa Group Subgroup
ECFp139744
  • ECF subfamily RNA polymerase sigma-24 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Roseivivax marinus ECF238 ECF238s18

>ECFp139744 ECF238 ECF238s18 Roseivivax marinus

1 MKETQTFVADGVTHPTYERRILQRCVMKNDQGDKFSLVDQSDVAAKSTDA
51 AVRHALVEGRHQILKFLRRRLGDPEAAEDVLQTFMLRAIDRSEQLRDVRA
101 VRGWLSQILASSIAEHGRKVSRQRQREVVMAPTDLEGVHHDFDEELDEVI
151 CNCLYKLLPTLKPEYAEVIWRVDLQEQPREDVAKDLGITLNNLNVRVHRG
201 RQALKTRLQQMCLTCPVHGFLDCDCDAAEKVRARLEGLADESEI

>ECFp26076 ECF238 ECF238s18 Agrobacterium tumefaciens

1 MTKSPIQSSPDADEDSADNGTKPYDTAVRRALIEARQEMLSFLQQRLRNR
51 SEAEEVLQRFSLRALERIDQLRDVQTVRGWLGRILATTLIDHQRAATRRK
101 RREVNGDQVDIGNIATAPDAELDAAICNCMHRLLPTLKPEYAEIVWRADI
151 LGEPRDRLAVSLSTSLNNINVRLHRGRAALKKRLEEMCRTCPIHGFLDCH
201 CEAGEIIRQTRSTMPPSDNDKG

Name Aliases LCA Taxa Group Subgroup
ECFp26071
  • RNA polymerase sigma-70 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Afipia sp. P52-10 ECF238 ECF238s18

>ECFp26071 ECF238 ECF238s18 Afipia sp. P52-10

1 MASNSHQDDMPASRGVEDHEAAKPHDRAVQSALVEAQKQILQFLQRRLGD
51 RDAADEVLQRFSLRALERASQLHDVRMVRGWLGRILATTIVDYQRETARR
101 RRREIVVDQAEVENHPVDEELDAAICNCLYRLLPTLKAEYADIIWRADIL
151 GEPRNRLAESLGTSLNNLTVRLHRGRQALRKRLEEMCRTCPVHGFLDCHC
201 EKGEQTQAFADAKAKTTP

>ECFp26011 ECF238 ECF238s18 Bradyrhizobium sp. YR681

1 MKSPNESLPAQTAGSLDAQDTVVRAALVGSYDRLRSYLQRRFGGKAEAEE
51 VLQAFMLRALERSGDIRDADSVRGWLSRVLATTIADFHRQISKSRTREMP
101 FPHELNDRLAASEDGAANAAVCECLYTHLSLLKPEHAEVIRRVDLAGEAR
151 ELVAADLGVTVNNLTVRLHRARHALKERLEQTCVVCLEENFWECRCADNR
201 GPT

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more