ECF proteins of ECF subgroup ECF238s15

Displaying all 20 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp26066
  • RNA polymerase sigma factor SigZ
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Hyalangium minutum ECF238 ECF238s15

>ECFp26066 ECF238 ECF238s15 Hyalangium minutum

1 MERIEREDGEPVVKALVDNHRHFLAFLERRVGSRAVAEELLQSAFVRSLE
51 KSGALRDEERAVAWFYRLLRNALVDHYRKQAAEGRALEHEAREATEVGPD
101 PELKQAVCACVGELLPTLKPEYSELLRQVELEERSVPEAAAAVGITPNNA
151 GVRLHRARQALKRQLEKSCGTCATHGCLDCSCQRRC

Name Aliases LCA Taxa Group Subgroup
ECFp26062
Myxococcus hansupus ECF238 ECF238s15

>ECFp26062 ECF238 ECF238s15 Myxococcus hansupus

1 MTQGKEHDVTRTEDLSDEVVRALVDNHRQFLGFLERRVGSRAIAEELLQT
51 AFVKTLEKGGALRDGEGAVTWFYRLLRNALVDHYRRSAAEGRALEREARE
101 VEETSVDAELKQAVCACVGELLPTLKPEYADILRQVDLEERGVPEVAREA
151 GITANNAGVRLHRARQALKKQLERSCGTCASHGCLDCTCKPAGQGGGNSV
201 GCPPGA

Name Aliases LCA Taxa Group Subgroup
ECFp26084
  • RNA polymerase sigma-70 factor, ECF subfamily
  • RNA polymerase sigma 70
  • ... more
Archangium gephyra ECF238 ECF238s15

>ECFp26084 ECF238 ECF238s15 Archangium gephyra

1 MREGNGEGELSPAVVESLVGNHRRFLAFLERRVGSRAQAEELLQSAYVRT
51 LEKGGELEDGEGAVAWFYRLLRNALVDHYRRQGAEGRALEREAREVSELG
101 PDPELTQTVCACIHDLLPALKPEYAEMVRQVDLEGRAVPEVAREAGITAN
151 NAGVRLHRARQALKKQLERSCGTCAAHGCLDCTCGKPGGGCAPSA

Name Aliases LCA Taxa Group Subgroup
ECFp2122
  • RNA polymerase sigma-70 factor, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Myxococcus xanthus ECF238 ECF238s15

>ECFp2122 ECF238 ECF238s15 Myxococcus xanthus

1 MCEAGAMSPEVLALLLQNRQRFLAFLTPHVGSVEAAEEVLQAALLKSVER
51 GSTLREEERAVAWFYRLLRNALIDRYRHEQRQGRALRAFAEESPLSTEDA
101 AELERTVCACVSTLTTTLKPEYSDALQRVDLDGQTLAEFAEAAGITHTNA
151 KVRLHRARQALGRRLEQACGTTCCRKGCVDCPCEEAGGL

Name Aliases LCA Taxa Group Subgroup
ECFp26063
  • ECF family RNA polymerase sigma factor
  • MYSTI_07104
  • ... more
Myxococcus stipitatus DSM 14675 ECF238 ECF238s15

>ECFp26063 ECF238 ECF238s15 Myxococcus stipitatus DSM 14675

1 MSLDARVVEILVAERRRFLAFLSPRVGSPEEAEEVLQLALVKGLEKSEGL
51 RDEESAVAWFYRLLRNILVDRHRKAQRESRLLAAEDAEAPRTTEDTDALE
101 TSVCACVAELTDTLKPEYSEAIRRVDLEGTPVSVFAREEGLTANNAAVRL
151 HRARQALGKRLIELCGTCCTHGCVDCACGEAGRPRVTPES

>ECFp26100 ECF238 ECF238s15 Myxococcus fulvus 124B02

1 MSTSENTEAMREEGDAVTRALVENHRQFLAFVERRVGNRATAEEILQSAF
51 VKSLESQRVLDDDEGAVTWFYRLLRNALVDHYRHQQVEGRALAREALGAE
101 EPSEDPELRQAVCACVGELLPTLKPEYAQMVREVDLEERSVPDVAWEVGI
151 TPNNAGVRLHRARQALKKQLERSCGTCASHGCLDCSCKARS

>ECFp26097 ECF238 ECF238s15 Myxococcus fulvus

1 MSLDARVLETLVAQRRRFLAFLAPRVGSPEEAEEVLQLALVKGLEKGEAL
51 RDEESAVAWFYRLLRNVLVDRHRRAQRESQALALEEAQAPRSTEDTAALE
101 STVCACVAGLADTLKPEYAKAIRRVDLEGTPVSTFAGEEGLTANNAAVRL
151 HRARQALGRRLIELCGTCCTHGCVDCVCAPDRPRVGDAPSS

Name Aliases LCA Taxa Group Subgroup
ECFp26061
  • ECF subfamily RNA polymerase sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Corallococcus coralloides DSM 2259 ECF238 ECF238s15

>ECFp26061 ECF238 ECF238s15 Corallococcus coralloides DSM 2259

1 MEAEGPDAGLPPDREDVVAALLAHQRRFVAFVERRVGSRAVAEDLFQTAF
51 ARTLEKGGALKDGESAVAWFYRLLRNALVDHHRRQAAEGRALEVEARDAD
101 SATVDLELKGAVCACLTDLLPTLKPEYAQLVRQVDLEGRAVPDVAREAGI
151 TPNNAGVRLHRARLALKRSLERGCGACAAHGCLDCSCKPRR

>ECFp26089 ECF238 ECF238s15 Archangium violaceum Cb vi76

1 MREGNGEGALSPAVVESLVGNHRRFLSFLERRVGSRAQAEELLQSAYVRT
51 LEKGGELEEGEGAVAWFYRLLRNALVDHYRRQGAEGRALEREARAASELG
101 PDPELTQTVCACIHDLLPALKPEYAEMVRQVDLEGRGVPEVAREAGITAN
151 NAGVRLHRARQALKKQLERSCGTCAAHGCLDCTCGKPGGGCEPSA

Name Aliases LCA Taxa Group Subgroup
ECFp26059
  • sigZ
  • ECF subfamily RNA polymerase sigma factor
  • ... more
Corallococcus coralloides DSM 2259 ECF238 ECF238s15

>ECFp26059 ECF238 ECF238s15 Corallococcus coralloides DSM 2259

1 MSLSPEAMDALLRHHHAFLAFLTPRLGSQEAAREVLQAAFVKGMEQGGSL
51 REEQSAVAWFYRLLRNALVDRHRRGQREVSTLESLAHEQPLSTEDANGLE
101 ATVCGCVAGLAGTLKPEYAEAVRRVDLEGLSVATYAQEAGISANNAAVRL
151 HRARKALGEQLVELCGHCCAQGCVDCDCAPT

Name Aliases LCA Taxa Group Subgroup
ECFp26041
  • ECF subfamily RNA polymerase sigma factor
  • RNA polymerase sigma 70
  • ... more
Myxococcus fulvus HW-1 ECF238 ECF238s15

>ECFp26041 ECF238 ECF238s15 Myxococcus fulvus HW-1

1 MGKEHGVTETGALNDEVVRALVDNHRQFLAFVERRVGSRAIAEEILQAAF
51 VRTLEKGGALEEGEGAVAWFYRLLRNALVDHYRRQAAEGRALEREARESV
101 VATEDPELKQAVCACVGELLPTLKPEYADILRRVDLEERGVPDVAREDGI
151 TANNAGVRLYRARQALKKQLERSCGTCASHGCLDCSCKPPRQAAGPTVPG
201 APVA

Name Aliases LCA Taxa Group Subgroup
ECFp26008
  • RNA polymerase sigma factor SigZ
  • RNA polymerase subunit sigma-70
  • ... more
Cystobacter fuscus DSM 2262 ECF238 ECF238s15

>ECFp26008 ECF238 ECF238s15 Cystobacter fuscus DSM 2262

1 MLLARVHFPPVDMRSPPPASNAASDTDPVREAVLRTLLDNRERFASFLAS
51 RVDSQAVVEELLQAAYVKALEKSAALRDEERAVAWFYRLLRNALTDHYRH
101 RSAEARALEREAREPLAVQPEPGAGSKVCACLHGVLPTLKPEYARMVRRV
151 DLEEHSVSEVAHEAGVTPNNAMVRLHRARQALKTRLQHTCGACAASGCLD
201 CSCRSGAS

>ECFp181034 ECF238 ECF238s15 Myxococcus virescens

1 MTETGQLSDEVVRALVDNHRQFLAFLERRVGSRAIAEEILQAAFVRTLEK
51 GGALKEGEGAVAWFYRLLRNALVDHYRRQAAEGRALEREAQEAEGAMVDT
101 ELKQAVCACVGELVPTLKPEYADILRKVDLAERGVPDVAREAGITANNAG
151 VRLHRARQALKRQLERSCGSCAAHGCLDCSCKPSHRAGEALASGSADV

>ECFp181030 ECF238 ECF238s15 Archangium sp. Cb G35

1 MREGNGEGELSPAVVESLVGNHRRFLSFLERRVGSRAQAEELLQSAYVRT
51 LEKGGELEEGEGAVAWFYRLLRNALVDHYRRQGAEGRALEREAREVSELG
101 PDPELTQTVCACIHDLLPALKPEYAEMVRQVDLEGRGVPEVAREAGITTN
151 NAGVRLHRARQALKKQLERSCGTCAAHGCLDCTCGKPGGGCKPSA

>ECFp181031 ECF238 ECF238s15 Myxococcus virescens

1 MSPEVLALLLQNRQRFLAFLTPHVGSVEAAEEVLQAALLKSVERGSTLRE
51 EERAVAWFYRLLRNALIDRYRHEQRQGRALRALAEESPLSTEDAAELERT
101 VCACVSTLTTTLKPEYSDALQRVDLDGQTLAEFAEAAGITHTNAKVRLHR
151 ARQALGRRLEQACGTTCCRKGCVDCPCEEAGGL

Name Aliases LCA Taxa Group Subgroup
ECFp139759
Stigmatella erecta ECF238 ECF238s15

>ECFp139759 ECF238 ECF238s15 Stigmatella erecta

1 MDPGKASEPRPLSEPARQRLVSNYPRFRAFLLRRTGSEPVAEEVLQGVLV
51 RVLERGAPALEGARWMAWFYRVLRNALADHVRHARAGERALAREARDAAG
101 AVLQPGLKRSVCQCLHRELEALKPEYARAVRQVDLEERSLAEAAEASGIT
151 PNNAAVRLHRARQALKKRLEKTCGACAAQGCLDCDCARSAAALVHERKDG
201 D

>ECFp139752 ECF238 ECF238s15 Stigmatella aurantiaca

1 MDPRKASEPRPLSEPARQLLVSNYPRFRAFLLRRTGSEPVAEEVLQGVLV
51 RVLERGAPALEGARLMAWFYRVLRNALADHVRHARAGERALAREARDAEG
101 AVLQPGLKRSVCQCLHRELEALKPEYAEAVRQVDLEERPLAEAAEASGIT
151 SNNAAVRLHRARQALKKRLEKTCGACAAQGCLDCDCARSAAALVYERKDG
201 G

Name Aliases LCA Taxa Group Subgroup
ECFp139740
Nannocystis exedens ECF238 ECF238s15

>ECFp139740 ECF238 ECF238s15 Nannocystis exedens

1 MTEPDRDLAPETPAAAARLVANHRRFLAFLQARVGSRALAEDILQDAFVR
51 GLGKLDGLRDEESAIAWFYRVLRNAVIDHQRRDAAASRRLDALAAELDPI
101 APASETHGAVCQCVGQLADNLKPEYAEALRRIELDGVAVKDYAAEAGITA
151 GNAAVRVFRAREALRRQVMRSCGTCAEHGCLDCTCAGPCGDAPKRA

Name Aliases LCA Taxa Group Subgroup
ECFp2130
  • RNA polymerase sigma-70 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Stigmatella aurantiaca DW4/3-1 ECF238 ECF238s15

>ECFp2130 ECF238 ECF238s15 Stigmatella aurantiaca DW4/3-1

1 MASISPMESPSDKQWRPLSEEARRMLVLRYPRFRSFLLRRTGSESVAEEV
51 LQGTLVRVLERGAPGLEGARLMAWFYRVLRNALADHFRHQRVSERALARE
101 AQAVAGEALQPALKPSPCQCLHRQLGALKPEYADAVRKVDLEEQSVAEVA
151 QSSGITANHAAVRLYRARKALKKQLEKTCGACAAGGCLDCDCARFAAALV
201 YERREGP

>ECFp181023 ECF238 ECF238s15 Cystobacter ferrugineus

1 MRSPPPPSHAASAPAPVREEALRTLLDHRDRFASFLASRVDSQVVVEELL
51 QAAYVKALEKSAALRDEERAVAWFYRLLRNALTDHYRHRSAEARALEREA
101 REPLSVQAEPGAGSKVCACLHGVLPSLKPEYAHMVRQVDLEEQSVSEVAR
151 EAGVTPNNAMVRLHRARQALKARLQHTCGACASSGCLDCSCRSEAS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more