ECF proteins of ECF subgroup ECF218s51

Displaying all 15 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp96377
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Tsukamurella paurometabola DSM 20162 ECF218 ECF218s51

>ECFp96377 ECF218 ECF218s51 Tsukamurella paurometabola DSM 20162

1 MSIDETGDRALLARAGTGDADAFAAIYDRHIRPVYWQAYAVLRDADAAQE
51 VGQDTFLTLWRRIEEVRVVDESVLPWLLATARYTALNAGRRLSVVRDRSA
101 PLDGDGSVADPAPSPEDALLASEVRHRIDSAVAALSPIDQRLYHLCVEGE
151 RTYDSAANELGVTHAAVRNRVSRLRTRLRADLSTLREQS

Name Aliases LCA Taxa Group Subgroup
ECFp95659
  • RNA polymerase subunit sigma-24
  • ASD11_12495
  • ... more
Aeromicrobium sp. Root495 ECF218 ECF218s51

>ECFp95659 ECF218 ECF218s51 Aeromicrobium sp. Root495

1 MDDDAALLERAQAGERGAFAALYTRHVRAVYWQAYGRLGDADLSEEVTQE
51 VFVTAWRRIRTVHVVDASVLPWLMVTARNLAMNQVRRRSRPDRSTIPLDD
101 TSPADHDVEATVEAALVRQEIEKAVGQLSSTDRRLYELCLEEGRSYDQAA
151 RELGVTQAAVRNRLSRLRQRLRADLRAMRELS

>ECFp94961 ECF218 ECF218s51 Aeromicrobium

1 MSRPRTSETGDDADTDGGLLQRASTGDRDAFGELYDRHVRAVYWQAFRVL
51 RDADAAEDATQETFVVAWRRSRTIRLVDGSVLPWLLVTARQVALNAARKA
101 ARRRTAELDEDLPARDDVESTVEAELARVEIDAAVAALGELDQRLYALCI
151 DGDHSYEQAARELGVTHAVVRNRLHRLRGRLRADLRAMRETS

Name Aliases LCA Taxa Group Subgroup
ECFp85414
  • RNA polymerase subunit sigma-24
  • Sigma-70 region 2
  • ... more
Aeromicrobium marinum DSM 15272 ECF218 ECF218s51

>ECFp85414 ECF218 ECF218s51 Aeromicrobium marinum DSM 15272

1 MEPTSTPAPDDRALLGRARSGDRTAFSELYDRHVRAVYWQAFGVVRDDDL
51 AEDVTQEVFITAWRKLHGIDVVDESLLPWLLVTARYTALNARRGRLRQEA
101 RQTDLTDDAPAPGSVEADVVAAQVRDEIARAVARLSETDRRIYDLCVDGN
151 HSYEQAAGDLGLSHAAVRNRLSRLRSRLRADLHAIREPA

Name Aliases LCA Taxa Group Subgroup
ECFp84729
  • hypothetical protein
  • HGAM_RS18280
Aeromicrobium massiliense JC14 ECF218 ECF218s51

>ECFp84729 ECF218 ECF218s51 Aeromicrobium massiliense JC14

1 MTPDPVADDHALVSRARAGDREAFGELYARHVRPVYWQAYGVVGSAADAE
51 EVVQEVFVVAWRRLDDLHLVDASVLPWLLVTAKNIGRNHARRTTRRRWEA
101 YDDTAPSADAPLDDQVATALVLDRLRDSVAGLSDVDRRLFELCVVGDRTY
151 AEAADELGLTHGGIRNRVSRLRGRLRRDTDDLRGLA

>ECFp84726 ECF218 ECF218s51 Tsukamurella pulmonis

1 MRTDESADRALLARAAGGDGAAFAAIHDRHVRAVYWQAYSVLHDADAAQE
51 VVQDTFLTLWRRIDSVRIVDESVLPWLMTTARYTALNTGRRLAAVRDRSA
101 PLDTVEPPDAAASPEDEVLAAEVRGLIADAVHALSPTDQRLYRLCVEDER
151 TYERAAAEVGVSHAAVRNRVSRLRSRLRADLSTLREQS

>ECFp82923 ECF218 ECF218s51 Tsukamurella tyrosinosolvens

1 MRTDESADRTLLARAAGGDGSAFAAIHDRHVRPVYWQAYTVLRDADAAQE
51 VAQDTFLTLWRRIDAVRIVDESVLPWLLTTARYTALNAGRRLSAVRDRAA
101 PLDDAEPPGAAPSPEDEVLAAEIRALIAAAVDALSPTDQRLYRLCVEDEQ
151 TYERAAAEVGVTHAAVRNRVSRLRGRLRADLSTLREQS

>ECFp79451 ECF218 ECF218s51 Aeromicrobium sp. Root344

1 MTPPTTTAEGTGDRELLARASAGDRAAFGQLYDRHVRPVYWQAYAVVRDQ
51 REAEDVTQEVFITTWDKIRRITVVDDSVLPWLLVTARYTALNARRRSQKV
101 SARSIQLDADLPDDASVEDEVVAAQVRGEIDKAVAALSPTDQRLYEMCVA
151 GDHTYELAARELGVSHAAVRNRVSRLRTRLRADLRSMRETS

>ECFp78607 ECF218 ECF218s51 Tsukamurella pseudospumae

1 MRTDESADRTLLTRAAGGDGTAFAEIYDRHVRPVYWQAYAVLRDADAAQE
51 TAQDTFLTLWRRIDSVRIVDESVLPWLLTTARFTALNAGRRLTAVRDRSA
101 PLDGAGEDPPGAAPSPEDEVLAGEIRDLIADAVHDLSPTDQRLYRLCVEG
151 EQTYERAAAELGVTHAAVRNRVSRLRGRLRADLSTLREQS

Name Aliases LCA Taxa Group Subgroup
ECFp77243
  • RNA polymerase subunit sigma-24
  • BN39_RS00785
Tsukamurella sp. 1534 ECF218 ECF218s51

>ECFp77243 ECF218 ECF218s51 Tsukamurella sp. 1534

1 MTTDEAADRALLARAAGGDGAAFAEIYDRHVRPVYWQAYTVLRDADAAQE
51 TTQDTFLTLWRRIGEVRIVDESVLPWLLTTARYTALNVGRRLAAARDRAA
101 PLDADAAGPDGAPSPEDEVLSAEIRRIIAAAVEALSPTDRRLYRLCVEGE
151 HTYDSAARELGVTHAAVRNRVSRLRSRLRADLSTLREQS

Name Aliases LCA Taxa Group Subgroup
ECFp113042
Mumia flava ECF218 ECF218s51

>ECFp113042 ECF218 ECF218s51 Mumia flava

1 MLLARMRRGDRDALGLLYERHVRPVYWQAYRVVGVDADAEEVVQDVFVTA
51 WRRRDDIHVVDRSVLPWLLATAKYTALNHQRRRRRRAWAELDENVASIHP
101 GPDDVVVADLVLERVHEHVRSLSTLDQRLFSLCVAGDRSYAEAADELGVT
151 HGTVRNRVSRIRSRVRTATEDLRGPA

Name Aliases LCA Taxa Group Subgroup
ECFp111692
  • RNA polymerase subunit sigma-24
  • ASE12_16750
  • ... more
Aeromicrobium sp. Root236 ECF218 ECF218s51

>ECFp111692 ECF218 ECF218s51 Aeromicrobium sp. Root236

1 MTSPTTTAEGDRELLARAAAGDRAAFGQLYDRHVRPVYWQAYAVVRDQRE
51 AEDVTQDVFITTWDKIRRITVVDDSVLPWLLVTARFTALNARRRSQKVKT
101 RSIQLNADLPDDASVEDEVVAGQIRGEIEKAVAALSPTDQRLYEMCVAGD
151 DTYESAARELGVSHAAVRNRVSRLRTRLRADLRSMRETS

>ECFp106072 ECF218 ECF218s51 Tsukamurella pulmonis

1 MRTDESADRALLARAAGGDGAAFAAIHDRHVRAVYWQAYSVLHDADAAQE
51 VAQDTFLTLWRRIDSVRIVDESVLPWLMTTARYTALNTGRRLAAVRDRSA
101 PLDTVEPPDAAASPEDEALAAEVRGLIADAVHALSPTDQRLYRLCVEDER
151 TYERAAAEVGVSHAAVRNRVSRLRSRLRADLSTLREQS

>ECFp103486 ECF218 ECF218s51 Tsukamurella tyrosinosolvens

1 MRTDESTDRTLLARAAGGDGSAFAAIHDRHVRPVYWQAYTVLRDADAAQE
51 VAQDTFLTLWRRIDAVRIVDESVLPWLLTTARYTALNAGRRLSAVRDRAA
101 PLDDAEPPGAAPSPEDEVLAAEIRGLIAAAVDALSPTDQRLYRLCVEDEQ
151 TYERAAAEVGVTHAAVRNRVSRLRGRLRADLSTLREQS

Name Aliases LCA Taxa Group Subgroup
ECFp100252
  • RNA polymerase subunit sigma-24
  • ASF35_14800
  • ... more
Aeromicrobium sp. Leaf291 ECF218 ECF218s51

>ECFp100252 ECF218 ECF218s51 Aeromicrobium sp. Leaf291

1 MSRPRTSETGDDADTDGGLLQRASTGDRDAFGELYDRHVRAVYWQAFRVL
51 RDADAAEDATQETFVVAWRRSRTIRLVDGSVLPWLLVTARQVALNAARKA
101 ARRRTAELDEDLPAGDDVESTVEAELARVEIDAAVAALGELDQRLYALCI
151 DGDHSYEQAARELGVTHAVVRNRLHRLRGRLRADLRAMRETS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more