ECF proteins of ECF subgroup ECF218s41

Displaying ECF 1 - 20 of 23 in total
Name Aliases LCA Taxa Group Subgroup
ECFp2224
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • Celf_0524
Cellulomonas fimi ATCC 484 ECF218 ECF218s41

>ECFp2224 ECF218 ECF218s41 Cellulomonas fimi ATCC 484

1 MPTPTPTTPVADVTADGDAAAARTGTGPGDEDAVRDETPHEGDEPRFETP
51 EDAAGAGPAPTSAPAAAPTPADTAWFETLVRDHATAVHRFVVRRVGRNDA
101 DDLTADVLTVAWRRRDDVPRGAELPWLYRTAGFVLANHVRKSRPVPVADV
151 PEGLDPTDPAVLAVRDEQVRTVLAALGVRDRQILLLNAWEGLAGQALADV
201 LGISRGGADAALSRARARLREAWDAHDADTPAGSTA

>ECFp135495 ECF218 ECF218s41 Cellulosimicrobium

1 MTTDEGSDETTEAAVHDEAWFAALFAAHATPLYRYFRRRLPSAVGGVAPD
51 ADDLTAEVLATAWRRRADVPDGAELPWLYRTAGFLLANHRRKARALPVAE
101 VPERPDDGADVEHVVVQDDEVRRALGALSDRDRRILLLHAWEGLGGADLA
151 AVLGTSRGGADAALSRARARLRTAWAEQSALAQETGA

Name Aliases LCA Taxa Group Subgroup
ECFp2241
  • RNA polymerase
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Cellulomonas flavigena DSM 20109 ECF218 ECF218s41

>ECFp2241 ECF218 ECF218s41 Cellulomonas flavigena DSM 20109

1 MQDRADLGVPGDVPADAAARTPAGPRDASWYERLVHVHATAVHRYVVRRV
51 GASDAEDLTADVLTVAWRRRDDVPEGAELPWLYRTAAYVVANHRRRARPV
101 PVADVPDEADADDPALRAVRDETVRAVLAGLSARDREVLLLHAWEGLTGE
151 GLAAALGIGRGGADAALSRARSRLRVAFAALD

Name Aliases LCA Taxa Group Subgroup
ECFp2213
  • RNA polymerase
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Isoptericola variabilis 225 ECF218 ECF218s41

>ECFp2213 ECF218 ECF218s41 Isoptericola variabilis 225

1 MPPGETTDHDDAWFDALFQEHASAIHRYFARRLPASAGGRADEAEDLAAE
51 VLATAWRRRDDVPAGAELPWLYRTAGFVLANHRRKARALPVAAVPDEPDD
101 VDPESMTLDDDRLRRVLARLTPRDRRILLLVAWDGLDGAALAEVLGVSRG
151 GADAALSRARARLRLAWDEETDGTDRASAGASAGASVRSDDGDAQARTR

>ECFp177679 ECF218 ECF218s41 Cellulomonas sp. 73-145

1 MSARTSLEPTTVSAHDEAWFTTLVRQHATAVHRYLVRRDGIGDADDLTAD
51 VLVVAWRRREDVPEGAELPWLYRTAAYVLANHRRKVRPLVMEQLPEPPEA
101 DDDPALRAVGDERVRRVLAGLAPRDRQILLLAAWEGLGGAELAAVLGIGR
151 GGADAALSRARARLAAAWTADQD

Name Aliases LCA Taxa Group Subgroup
ECFp156097
Cellulomonas marina ECF218 ECF218s41

>ECFp156097 ECF218 ECF218s41 Cellulomonas marina

1 MAHDRPAPAAPDAPDRAPQHDAAWYEDLVRTHLRDVHRYLVRRAGAGDAE
51 DLTAEVLTVAWRRRADVPAGAELPWLYRTAGFVLANHRRKVVPLPVADVP
101 ERLDDDDPAWRAVQDDAVRRALSGLSPRDREVLLLHAWEGLTGAALGAVL
151 GVSTGGADAALSRARSRLRAAWADLEGTA

>ECFp156052 ECF218 ECF218s41 Cellulomonas sp. KH9

1 MPAHPEHDTDPRTDPTAVGTAHGDAVPTGAPDPDTVAADGGRGAAWFEDL
51 VRAHATAVHRYVLRRVAPSDVEDLTADVLTVAWRRRDDVPEGAELPWLYR
101 TAGYVVANHRRKSRPVPVADVPEETDADDPALRAVRDDTVRTVLAGLSAR
151 DREVLLLHAWEGLTGDALAAALGTGRGGADAALSRARARLRTAFAAAGVD
201 G

>ECFp136069 ECF218 ECF218s41 Isoptericola dokdonensis DS-3

1 MTTTTEAPPHDGAWFDALFAAHAAAVHRYFVRRLATSRDDAEDLAAEVLA
51 TAWRRRDDVPVGGELPWLYRTAGYVLANHRRKARALPVAAVPEEPDDVDP
101 AELALDDDRVRAVLARLSARDRRVLLLVAWDGLGGDDLAAVLGVSRGGAD
151 AALSRARARLRTAWSEAEQDDDQTGAPPGGDRTADGAARAANDEA

>ECFp136041 ECF218 ECF218s41 Promicromonospora kroppenstedtii DSM 19349

1 MDDSPGAPHDEPPQHDEAWFGALFDAHSRALYSYFVRRLPDGGRASDAED
51 LAAEVLATAWRRRDDVPDAAELPWLYCTAGYVLANHRRKMRALPVAVVPD
101 EPDDVDPATLAVDDDAVRQVLSLLSPRDRRILLLVAWDGLSGDDLAQVLG
151 VSRGGADAALSRARARLREAWDAHEQAVDA

>ECFp136006 ECF218 ECF218s41 Cellulomonas sp. Leaf334

1 MRAAADGSPDGGDAGTLHDAAWFEALVRTHATAVHRFVVRRAGRDEAEDL
51 AADVLTVAWRRRADVPDGAELPWLYRTAGFVVANHRRKGRPVPVGDVPDE
101 VDSDDPAVRAIQEERVREVLGALSPRDREILLLNAWEGLSGDGLAQVLGI
151 GRGGADAALSRARARLREAWTTAES

Name Aliases LCA Taxa Group Subgroup
ECFp136002
  • RNA polymerase
  • K415_RS0103740
Cellulomonas sp. KRMCY2 ECF218 ECF218s41

>ECFp136002 ECF218 ECF218s41 Cellulomonas sp. KRMCY2

1 MRDDAWFDGLFRAHSTAVYRYFARRAALDDAQDLTADVLATAWRRREDVP
51 EGAELPWLYRTAGYVLANHRRKGRPVPVEVVPDEPDDADPADLTLADEEV
101 RGVLAALSPRDRRILLLHAWEGLDGDQLAAALGISRGGADAALSRARARL
151 RQVWAERDAVGDVPGASNAAGATQAR

>ECFp135945 ECF218 ECF218s41 Cellulomonas sp. Root485

1 MADDADGSTPGSTSPHDAAWFEALVLQHATAVHRFMVRRAGRDEAEDLAA
51 DVLTVAWRRRADVPDGAELPWLYRTAGFVVANHRRKGRPIPVGDVPDEVD
101 SDDPAVRAIQEERVREVLGALSPRDREILLLNAWEGLTGDALAQVLDIGR
151 GGADAALSRARARLREAWASAEA

Name Aliases LCA Taxa Group Subgroup
ECFp135948
  • hypothetical protein
  • H291_RS0125735
Promicromonospora sukumoe 327MFSha3.1 ECF218 ECF218s41

>ECFp135948 ECF218 ECF218s41 Promicromonospora sukumoe 327MFSha3.1

1 MDDSPGAPHDEPPQHDEAWFGALFDAHSRALYSYFVRRLPDGGRASDAED
51 LAAEVLATAWRRRDDVPDAAELPWLYRTAGYVLANHRRKMRALPVAIVPD
101 EPDDVDPATLAVDDDAVRQVLSLLSPRDRRILLLVAWDGLSGDDLAQVLG
151 VSRGGADAALSRARARLREAWDAHEQAVDA

>ECFp135805 ECF218 ECF218s41 Cellulomonas iranensis NBRC 101100 = JCM 18110

1 MTRDGAASPAGPATPRDAPWFEALVRDHATAVHRYLVRRVPASDVEDLAA
51 DVLTVAWRRRDDVPEGAELPWLYRTAGFVVSNHRRKGRPVPVADVPEGVD
101 ADDPALRAVRDETVRTVLAGLSARDREVILLHAWEGLTGDALAEVLGIGR
151 GGADAALSRARSRLRAALDDAGVA

>ECFp135760 ECF218 ECF218s41 Cellulomonas sp. Leaf395

1 MGSVHDAAWFEALVRQHATAVHRFVVRRAGRDDAEDLAADVLTVAWRRRA
51 DVPDGAELPWLYRTAGFVVANHRRKGRPVPVADVPDDVDSDDPAVRAVQE
101 ERVREVLGALSPRDREILLLNAWEGLTGDALAQVLGIGRGGADAALSRAR
151 ARLREAWASAEA

Name Aliases LCA Taxa Group Subgroup
ECFp135684
  • hypothetical protein
  • CELF_RS02610
Cellulomonas fimi ATCC 484 ECF218 ECF218s41

>ECFp135684 ECF218 ECF218s41 Cellulomonas fimi ATCC 484

1 MVRDHATAVHRFVVRRVGRNDADDLTADVLTVAWRRRDDVPRGAELPWLY
51 RTAGFVLANHVRKSRPVPVADVPEGLDPTDPAVLAVRDEQVRTVLAALGV
101 RDRQILLLNAWEGLAGQALADVLGISRGGADAALSRARARLREAWDAHDA
151 DTPAGSTA

>ECFp135680 ECF218 ECF218s41 Cellulomonas sp. FA1

1 MTRDGAASPARPATPRDAPWFEALVRDHATAVHRYLVRRVPASDVEDLAA
51 DVLTVAWRRRDDVPEGAELPWLYRTAGFVVSNHRRKGRPVPVADVPEGVD
101 ADDPALRAVRDETVRTVLAGLSARDREVILLHAWEGLTGDALAEVLGIGR
151 GGADAALSRARSRLRAALDDAGVA

Name Aliases LCA Taxa Group Subgroup
ECFp135688
  • RNA polymerase subunit sigma-24
  • K330_RS0100380
Ornithinimicrobium pekingense DSM 21552 ECF218 ECF218s41

>ECFp135688 ECF218 ECF218s41 Ornithinimicrobium pekingense DSM 21552

1 MALRLAGEGGADAGSVPGTLLRDAPWFDGFFAQHATSVHRYFVRRASHVD
51 VEDLTAEVFATAWRRREKIPEGFELPWLYKTASYVLANHRRKPTLTLVSD
101 YSAQEEGQTARSVDPAELVMADDEVRRALARLSARDRTVLMLHAWEGLDG
151 EGMAAALGLTRGGAAAALSRARARLREAWDEDH

>ECFp135715 ECF218 ECF218s41 Cellulomonas sp. URHD0024

1 MRAHSTAVHRFLVRRTGRDDADDLTADVLTIAWRRRDDIPDGAELPWLYR
51 TAGFLVANHRRKARPLPVADVPDEADPFGSSDPAHLFVEDEQVRTVLGAL
101 GARDRQILLLNAWEGLVGEGLAAVLGISRGGADAALSRARARLREAWAAA
151 DA

Name Aliases LCA Taxa Group Subgroup
ECFp135545
  • hypothetical protein
  • RNA polymerase
  • ... more
Cellulomonas bogoriensis 69B4 = DSM 16987 ECF218 ECF218s41

>ECFp135545 ECF218 ECF218s41 Cellulomonas bogoriensis 69B4 = DSM 16987

1 MRTRGAPASTGGASVHDDSWFEGLFREHAGAVHRYFARRVAPDDVQDLTA
51 DVLVTAWRRRADVPDGAELPWLYRTAGYVLANHRRKARPVPVEDVPEDAD
101 DVDPADLVVADQQVRAVLAVLSPRDRRILLLHAWEGLTGADLAVVLGVGR
151 GGADAALSRARARLRQAWSEQQDGFRPPASPVVGETQTG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more