ECF proteins of ECF subgroup ECF218s34

Displaying ECF 1 - 20 of 27 in total
Name Aliases LCA Taxa Group Subgroup
ECFp135275
Planobispora rosea ECF218 ECF218s34

>ECFp135275 ECF218 ECF218s34 Planobispora rosea

1 MGVDDPEARFTALYDRHYRNVLGYALLRAERQAAEDVASETFLIAWRRLD
51 SVPDRPLPWLLGVARNLLRKHHERGPRWVTSAERLVALVPEGDVADEVSE
101 RRAALEALAVLPEHEVEAVILASWYGLGPAEAAKVAGCSARAFSVRLHRA
151 RRRLADALNLARTTLQEQR

>ECFp177632 ECF218 ECF218s34 Lentzea jiangxiensis

1 MEDFSAVYRECYPRVLAYAASHAGSRLAEDITSETFTIAWRKLDRMPSNA
51 LPWLIGIARNLVREARRQTTHYELADLPADDAFAVIELRAALASLSESDQ
101 EVLTLIAWHGLGAAEAAQVLGCTTATFFVRLHRARRRLQAALSSANFDRA
151 RESWKTS

>ECFp177628 ECF218 ECF218s34 Lechevalieria fradiae

1 MEDFPAVYRECYPRVLAYAASHAGARLAEDITSETFTIAWRKLDQMPSNA
51 LPWLLGIARNLVRAARRQATHYELMDVPAADDLAVIELGAALTSLAESDQ
101 EVLTLIAWHGLTSAEAAQVLGCTTATFSVRLHRARRRLQAALSTPTTDRA
151 RESWKTS

Name Aliases LCA Taxa Group Subgroup
ECFp177656
Microbispora rosea ECF218 ECF218s34

>ECFp177656 ECF218 ECF218s34 Microbispora rosea

1 MNDSEERFTNLYDRHYRAVLGYALLRADHSVAEDVCSETFLVAWRRLAEL
51 PEPVLPWLLGVARNLLAKQRDSRGRRKALVDRIAALGTERDNVAWDIADH
101 VVDRDTALAALATLPEQDVEAMALASWHGLPPEQAAAVMGCSTRTYNVRL
151 HRARKRLVRALRAESNRSTSPARTAAGRQRFAEET

>ECFp156093 ECF218 ECF218s34 Lechevalieria xinjiangensis

1 MEEFATVYRECYPRVLAYAASHAGARLAEDITSETFTIAWRKSAQMPSNA
51 LPWLLGIARNLVRETRRQTTHYELTDFPAEDEFAVIELRAALSSLSEADQ
101 EVLTLIAWHGLAAAEAAQVLGCTPATFFVRLHRARRRLQAALWTPKFDSA
151 RESWKTS

Name Aliases LCA Taxa Group Subgroup
ECFp156057
Nonomuraea pusilla ECF218 ECF218s34

>ECFp156057 ECF218 ECF218s34 Nonomuraea pusilla

1 MDDSKARLTALYEQHYRSVLSYVLLRADQETAEDIASETFVIAWRKLGRL
51 PEPPLPWLLGVARNLVRTQRRTTARRHNLVARLAELAPADDVAEQVAERQ
101 AALTALAELSELDAEAVLLASWYGLTPAEAAKITGCSARTFNVRLHRARR
151 RLTDALNLTQPTFLEQS

>ECFp156013 ECF218 ECF218s34 Lentzea flaviverrucosa

1 MEEFSSVYRECYPRVLAYAASHAGPRLAEDITSETFTVAWRRLDQMPSNA
51 LPWLLGIARNLVRSARRQTTHIELTDFPAEDDFAVIELRAALASLSEADQ
101 EVLTLIAWHGLAAAEAAQVLGCTTATFFVRLHRARRRLQAALWTPNFDRA
151 RASWKTS

>ECFp156051 ECF218 ECF218s34 Nonomuraea wenchangensis

1 MDDPQERFTGLYDRYYRNVLGYVLLRVEQGVAEDVCSETFLVAWRRLDEL
51 PEQVLPWLLGVARNKLAKQREVRFRRKDLVERIAALTSEQEHVAWDVAEY
101 VVDREQAISALRALPEKDVEAMILVSWYGLTPDQAATVMGCSARAFNVRL
151 HRARKRLHGRLRQEAGAAQRPVRQTSSRFAEES

>ECFp136083 ECF218 ECF218s34 Herbidospora mongoliensis

1 MDDPETRFTDLYDLHYRAVLGYALLRADRPAAEDVAGETFLIAWRRFADL
51 PPEPLPWLLGVARNLLRKQRDSGIRAERLLAYLPAADSPDVADQVTEREA
101 ALRALAAMAEADAEALILTSWYGLAPREAAKIAGCAPGAFTVRLHRARRR
151 LTEALRPRTLQEQP

>ECFp136070 ECF218 ECF218s34 Actinomadura kijaniata NBRC 14229

1 MYDTYYRRVLAYALTHAEPHTAEDIVSETFLIAWRRLGDVRDPALPWLLG
51 TARNLVRKQYDHGRRGRVLAERIRTLTTPQDLAAWDVAEHVVERDVALAA
101 IAGLPERDLEVLALVNWHGLEPRQAAKVLGCTSAAFFVRLHRARRRLTRA
151 LEQNPAPRSAVSRVAERATS

Name Aliases LCA Taxa Group Subgroup
ECFp135973
  • hypothetical protein
  • MPTA5024_15470
  • ... more
Microbispora sp. ATCC PTA-5024 ECF218 ECF218s34

>ECFp135973 ECF218 ECF218s34 Microbispora sp. ATCC PTA-5024

1 MNDPHERFTDLYDRHYRSVLGYALLRADRGAAEDVVSETFLVAWRRLEEM
51 PEAELPWLLGVARNLLAKQRDSRRRGLSLVDRVTALSTTHDHVAWDVAEH
101 VVDRQSALAALASLPERDVEALALATWHGLPPDQAAAVMGCSVRTYNVRL
151 HRARGRLARALRSEPKAARPTAPAVPRRYAEEA

Name Aliases LCA Taxa Group Subgroup
ECFp135913
  • hypothetical protein
  • P696_RS0110445
Actinomadura oligospora ATCC 43269 ECF218 ECF218s34

>ECFp135913 ECF218 ECF218s34 Actinomadura oligospora ATCC 43269

1 MDEREARFTRLYETHYRSVFGYVALRVERQAAEDVTGEVFAVAWRKVDEI
51 PERALPWLLGVAKNLARRSHGATDHTRRLVDRLAALTDTASADRDAADGV
101 IARDQALSALAALSAKEAEAVTLTAWHGLDPAEAARVAGCSRAAFLVRLH
151 RGRRRLARTLDASAGDRETPEPIVRPRVSTEKS

>ECFp135868 ECF218 ECF218s34 Microtetraspora malaysiensis

1 MNDPYKRFTDLYDRHYRAVFGYVVLRAEPGTAEDVSSETFLVAWRRLDDV
51 PDPPLPWLLGVARNKLAKHRGVQHRRHALVDRIAALMTADDQTGRDVAER
101 VLDRETALTALRSLREKDLEALALTTWHGLTPDQAAAVMGCSTRTYNVRL
151 HRARARLSKAMRTMSPDRTVARNQLLEEM

>ECFp135825 ECF218 ECF218s34 Nocardia sp. NRRL S-836

1 MGEDITSETFTIAWRKLDEMPVPALPWLLGITRNLVRAARRQATHEELVD
51 VPVGDDFVQVVEIRAALASLAEADQEVLTLVAWHGLTAAEAATVLGCSTA
101 TFFVRLHRARRRLRTALSTPAFEYSR

>ECFp135832 ECF218 ECF218s34 Nocardia sp. NRRL S-836

1 MVEAFCAVYRECYPRVLAYAASHAGPRLGEDITSETFTIAWRKLDEMPVP
51 ALPWLLGITRNLVRAARRQATHEELVDVPVGDDFVQVVEIRAALASLAEA
101 DQEVLTLVAWHGLTAAEAATVLGCSTATFFVRLHRARRRLRTALSTPAFE
151 YSR

>ECFp135756 ECF218 ECF218s34 Streptomyces violaceorubidus

1 MTAAERFRSVYEEHYPRVLAYATSLVGRQVGEDITSEAFTVAWRRLNDMP
51 HPPLPWLLGVARNLVRELRRRDALQYTVAAEEAQRLTSGGQTHVGDVAAV
101 VTDRHVALQALASLSEADRELLTLIAWQGLSPRDAARVLNCTGPTLTVRL
151 YRARRRLEKALETAQAAEAAPVDGVHTAYPPHGQGAPA

>ECFp135765 ECF218 ECF218s34 Herbidospora cretacea

1 MDDPETRFTDLYDAHYRAVLGYALLRADRSAAEDVAGETFLIAWRRFADL
51 PPEPLPWLLGVARNLLRKQRDSGIRADRLLAHLPTGDSPDVADQVAERET
101 ALRALAAMAEADAEALILTSWYGLAPREAAKIAGCAQGAFTVRLHRARRR
151 LTEALRPRTLQEQS

Name Aliases LCA Taxa Group Subgroup
ECFp135673
  • hypothetical protein
  • IG98_RS0127145
Streptosporangium amethystogenes ECF218 ECF218s34

>ECFp135673 ECF218 ECF218s34 Streptosporangium amethystogenes

1 MDDPEARFTALYDRHYRSVLGYALLRAERQEAEDVASETFLIAWRQLERL
51 PEPPLPWLLGTARNLLRAQRRSGLRKRALADRLAELAPAGDVADQVAERE
101 VALAALADLSEQDVEAVVLASWYGLAPADAARLAGCSTRAFTVRLYRARR
151 RLSQALDLTSPIPCGTAPRPTPGSGPGVSELEVSDERR

>ECFp135632 ECF218 ECF218s34 Microtetraspora glauca

1 MDDPEERFTDLYDRHYRAVLGYALLRADRQTAEDATGETFLIAWRRLDDM
51 PDPPLPWLLGVARNLLRKQRHAGLRGRELAAGLAELAPESDGDVGERVAE
101 REAALAVLAAMPERDAEAVILASWYGLAPKDAARAAGCSARAFNVRLHRA
151 RRRLAEALRTTDKTLQEQT

Name Aliases LCA Taxa Group Subgroup
ECFp135560
  • hypothetical protein
  • IF49_RS0130080
Microbispora rosea subsp. nonnitritogenes ECF218 ECF218s34

>ECFp135560 ECF218 ECF218s34 Microbispora rosea subsp. nonnitritogenes

1 MNDSEERFTNLYDRHYRAVLGYALLRADHSVAEDVCSETFLVAWRRLAEL
51 PEPVLPWLLGVARNLLAKQRDSRGRRKALVDRIAALGTERDNVAWDVADH
101 VVDRDTALAALATLPEQDVEAMALASWHGLPPEQAAAVMGCSTRTYNVRL
151 HRARKRLVRALRAESSRSTSPARTAAGRQRLAEET

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more