ECF proteins of ECF subgroup ECF218s31

Displaying ECF 1 - 20 of 28 in total

>ECFp177714 ECF218 ECF218s31 Actinoplanes derwentensis

1 MTSEEHFRRLHDAAYTDLMRFVRRRVPDDEVDDIVSTVFMIAWRRLGELP
51 GDAVPWLFGVARNVMAAQSRTRNRHAVVDVRMVSDDRAPGVVARIDLVRA
101 WWTLSAADHEVLALVAFDGLTDTQAATVLGCRPTTYRMRLSRARRRLRDA
151 MSQPAPRPAPSWSPA

>ECFp135482 ECF218 ECF218s31 Streptomyces sp. FxanaA7

1 MPITTAAQFTDVYRAHYEDVLRFVRRRAHPMNVDDIVGETFLAAWRRRRE
51 LPDDPRPWLFGTARKVMLNDSRGMRRHTALAVRVQQAVETGGSTRAADPA
101 TLVGGRMDLAAAWQALTPADQEVLALQAWEQLSAKDAAKVLGCTRAAYAM
151 RLTRAKRRLAARLGTADATTPALATTF

Name Aliases LCA Taxa Group Subgroup
ECFp135857
  • RNA polymerase ECF-subfamily sigma factor
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Actinoplanes missouriensis 431 ECF218 ECF218s31

>ECFp135857 ECF218 ECF218s31 Actinoplanes missouriensis 431

1 MTGPQPDGAEDWFRALHQHTFADLLRFVERRVPADDAEDIVSTVYLTAWR
51 RRTELPEDARPWLFAVARKTMANRTRGWLRRRALDVRLTAAGNDATPDPA
101 TGLTARLDLQRAWQTLSAADREVLALVAFDDLTNEQAATVLGCRRSAFTM
151 RLARARKRLHAALEPAGATSSHAHTFQEQSWTKA

>ECFp135263 ECF218 ECF218s31 Isoptericola dokdonensis DS-3

1 MDDAEARAFLTRLWVDHHEDVVRFVARRASPDVVDDVVSETYLVAWRRVD
51 DVPTDARPWLFGVARNVLATQVRTHGRWRALGVRLEQQPSAEHEGADDAA
101 VERADLRRAWELLDPADREVIALVAWDGLTTTQAASVLGCRPSTFSVRLT
151 RARKRLLAFSEVPSGTADVLRNLQQEAR

Name Aliases LCA Taxa Group Subgroup
ECFp135524
  • RNA polymerase sigma factor
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Streptomyces cattleya NRRL 8057 = DSM 46488 ECF218 ECF218s31

>ECFp135524 ECF218 ECF218s31 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MLVADRYGCKRRKEAMPIDTEARFTEVYRAHYEDVLRFVRRRAQPMEVDD
51 IVAETFLAAWRRRRELRGDPRAWLFGTARNVMLNANRGTRRRTALAVHIQ
101 QTAHSAVHAPAADAMAQVDNRIDLVAAWQALAPADQEVLALHVWEGLAAR
151 EAAKVLGCTRAAYAMRLTRAKRRLAGHLAPAAPASPAVTVTD

Name Aliases LCA Taxa Group Subgroup
ECFp135450
  • RNA polymerase sigma factor
  • RNA polymerase sigma factor sigM
  • ... more
Actinoplanes sp. SE50/110 ECF218 ECF218s31

>ECFp135450 ECF218 ECF218s31 Actinoplanes sp. SE50/110

1 MAMVSELDFTELYQAHYVDVLRFVRRRASPEDADDIVGETFLTAWRRRAD
51 LPPEPRPWLFRTARNIMLNTQRGSRRQQAISIRIAHEPAEPVADAMGPVE
101 TRVDLSAAWRELTPRDQETLALHIWEALSDRDAAAVLGCTRATYTMRLMR
151 ARRRLARLLGPGAVVSSAATPAPHPTSTLAPTGWEHS

Name Aliases LCA Taxa Group Subgroup
ECFp2263
  • RNA polymerase sigma factor, sigma-70 family
  • Sked_29980
Sanguibacter keddieii DSM 10542 ECF218 ECF218s31

>ECFp2263 ECF218 ECF218s31 Sanguibacter keddieii DSM 10542

1 MDRPDHRAFTALYHAHYGAVLGFVRRRLPDASAEDVVADVFTTVWRRLDD
51 VPDEPRPWLYGVARHTLLTAQRGHARRAALSVRIASRPSGPTPDHSDGIA
101 DTLDLVAAWQRLSATHQEAIALVTHDGLTGAEAAQVLGCSRSAFSVRLVR
151 ARRALRTFLDIEARAASSADGPARQTKEMSREAR

Name Aliases LCA Taxa Group Subgroup
ECFp135939
  • hypothetical protein
  • WH85_RS12110
Actinoplanes rectilineatus ECF218 ECF218s31

>ECFp135939 ECF218 ECF218s31 Actinoplanes rectilineatus

1 MSSVTGPDAEQRFRDLHRATFADLLRFVERRIPVDEAEDVVSTVFLTAWR
51 RFGEVPEDARPWLFAVARRTMANRTRGWLRRRALDVRLDAAEPRHEPDSA
101 PGTAARIDLQRAWRELKAADREVLALVAFDGLTSDQAASVLGVRRSTFAM
151 RLGRARQRLQAALNPEATPTTLKEQESWTTA

>ECFp177743 ECF218 ECF218s31 Streptomyces sp. IMTB 2501

1 MPIDTEAQFTEVYRAHYEDVLRFVRRRAHPMNVDDIVGETFLAAWRRRRE
51 LPGNPRPWLFGAARNVMRNADRGMRRQSALVVHIQQTTAAGCHEPAVDVT
101 AQADSRVDLVAAWQSLTAADQEVLSLHVWEALDARDAATVLGCTRAAYAM
151 RLTRAKRRLAGRLHTAAVPASPALSLTH

>ECFp177663 ECF218 ECF218s31 Haloactinobacterium album

1 MKAGPEGRFETLYWENHRELLAFIRRRTEAEAEDIVAETFVVAWRRIDDV
51 PVDARPWLFGVARNVLRNHLRAQNRQLLLKVRIDQQPEEPQTDLATSIAN
101 RQDLADAWNRLTPAEQEVISLVAWEELSNDQAATVLGTTKSAFAVRLFRA
151 RRRLLHLLNRTTQKGGHHG

>ECFp177651 ECF218 ECF218s31 Paraoerskovia marina

1 MGPEISRQRGVTTTPVPATQGEQGYTDREGQAMGDREERFSEAFRAHYGE
51 LTRFVARRAPSRIVDDVVADTFATAWRRFDPEPTHVRPWLFAIAYNVMRT
101 QLRGLGRWESLQIRMDAEPPLPPSDLADEVALRTDVVEAFGRLRAADQEV
151 LSLAVWEELETAEAAQVLGCSSRAYLVRLHRARRRLSTMLAATTRRADVQ
201 GARS

>ECFp156105 ECF218 ECF218s31 Streptomyces sp. MUSC 14

1 MPIDTEAQFTEVYRAHYEDVLRFVRRRAHPMNVDDIVGETFLAAWRRRRE
51 LPGNPRPWLFGAARNVMLNADRGRRRQSALVVHIQQTTAAGCHEPAVDVT
101 AEVDSRMDLVAGWRSLTAADQEVLALHVWEALDARDAATVLGCTRAAYAM
151 RLTRAKRRLAGRLHTAAVPASPALSLTH

>ECFp156089 ECF218 ECF218s31 Lechevalieria xinjiangensis

1 MSGNALEERFRDLHRRTYPDLLRFVERRVPPAEAEDVVSVVYLTAWRRLR
51 DVPDDARPWLFGVARKAMANQTRGLLRRQALDVRIAEALDHLVPDGSAEV
101 AARIDLVRAWRTLSAADREVLALVAFDGLTADQAATVLGCRRTTFAMRLN
151 RARKRLDETLSPAQTTAPTGARA

>ECFp156016 ECF218 ECF218s31 Streptomyces sp. cf124

1 MPITTAAQFTDVYRAHYEDVLRFVRRRAHPMNVDDIVGETFLAAWRRRRE
51 LPDDPRPWLFGTARKVMLNDSRGMRRHTALAVRVQQAVETGGSTRAADPA
101 TLVGGRMDLAAAWQALTPADQEVLALQAWEQLSAKDAAKVLGCTRAAYAM
151 RLTRAKRRLAARLGTTDATTPALATTF

Name Aliases LCA Taxa Group Subgroup
ECFp136012
  • RNA polymerase sigma factor
  • K338_RS20260
Ruania albidiflava DSM 18029 ECF218 ECF218s31

>ECFp136012 ECF218 ECF218s31 Ruania albidiflava DSM 18029

1 MKADPDERFEALYEAHHQELLAFIRRRSTIGDAEDVVAETFVVTWRRIDD
51 VPDPARGWLFAVARNILRNHERSHHRQVSLRVHLAGHSATYSPDPASAIA
101 GRTDLARAWNRLTDAERETIALTAWDELTQEEAATVLGCTKAAYAVRLHR
151 ARRRLLHLIDRTTSGGRRG

Name Aliases LCA Taxa Group Subgroup
ECFp135964
  • RNA polymerase subunit sigma
  • KUTG_RS11390
Kutzneria sp. 744 ECF218 ECF218s31

>ECFp135964 ECF218 ECF218s31 Kutzneria sp. 744

1 METDAEFSAMYRAHYADVLAFARRRTVQADDVVGETFLAAWRRRRDLPPD
51 PRPWLFRTARNLMLNVDRSARRQRAVAVRVAEQDQGDGYEPMLTAEARMD
101 LVKAWRSLSTQDQELLALHAWEGLSDKEAATVLGCTRAAFSMRLSRAKRR
151 LAKHVGPVSDLPIAFANLNGAS

>ECFp135919 ECF218 ECF218s31 Streptacidiphilus jeojiense

1 MAIRTEAEYEAMYREHYPDVLRFVARRAEPAQADDIVGETFLTAWRKRGE
51 LPAEVRPWLFATARNAMLNAGRGRRRRQALAVRIAERPDPGHDPAPHVDA
101 RLDLADAWRRLSAGDQEALALVVWDGLSDVQAADVLGCSPSAFRMRLSRA
151 RARLRELLQLTAPAVPFVPAQRGAR

>ECFp135852 ECF218 ECF218s31 Isoptericola dokdonensis DS-3

1 MVDDAEARAFLTRLWVDHHEDVVRFVARRASPDVVDDVVSETYLVAWRRV
51 DDVPTDARPWLFGVARNVLATQVRTHGRWRALGVRLEQQPSAEHEGADDA
101 AVERADLRRAWELLDPADREVIALVAWDGLTTTQAASVLGCRPSTFSVRL
151 TRARKRLLAFSEVPSGTADVLRNLQQEAR

Name Aliases LCA Taxa Group Subgroup
ECFp135791
  • hypothetical protein
  • Q343_RS0113460
Paraoerskovia marina DSM 21750 ECF218 ECF218s31

>ECFp135791 ECF218 ECF218s31 Paraoerskovia marina DSM 21750

1 MPVPATQGEQGYTDREGQAMGDREERFSEAFRAHYGELTRFVARRAPSRI
51 VDDVVADTFATAWRRFDPEPTHVRPWLFAIAYNVMRTQLRGLGRWESLQI
101 RMDAEPPLPPSDLADEVALRTDVVEAFGRLRAADQEVLSLAVWEELETAE
151 AAQVLGCSSRAYLVRLHRARRRLSTMLAATTRRADVQGARS

Name Aliases LCA Taxa Group Subgroup
ECFp135790
  • hypothetical protein
  • BS72_RS04375
Streptomyces yeochonensis CN732 ECF218 ECF218s31

>ECFp135790 ECF218 ECF218s31 Streptomyces yeochonensis CN732

1 MAISTETDYEAMYRQHYQEVLRFVRRRADAAQVDDIVVETFTIAWRKRRS
51 LPEDVAPWLYATARNTMLNAHRGLRRRAALAVRIAGQPRDDSYDPAGAAD
101 ARIDLGAAWRRLAARDQEVLSLVVWEGLTDAQAAVVLGCSPSSVRMRLSR
151 ARGRLRELLGPVAVVPSGQRVSR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more