ECF proteins of ECF subgroup ECF218s29

Displaying ECF 1 - 20 of 30 in total
Name Aliases LCA Taxa Group Subgroup
ECFp2219
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Sanguibacter keddieii DSM 10542 ECF218 ECF218s29

>ECFp2219 ECF218 ECF218s29 Sanguibacter keddieii DSM 10542

1 MTSTRSRQLLTAALGECSDDLLRYFLRRLDREDAADALADVMTTAWSRVD
51 ALPTAPTEARMWLFGIARNVLLHAQRGSSRRSRLADRLRSTLGQRTASSA
101 DHGVEIRDAIDRLDPDLAELVRLVHWDGFSLTDAADLLGIPASTARGRYQ
151 RAKETLRDVLAPTPR

>ECFp135246 ECF218 ECF218s29 Microbacterium sp. 292MF

1 MTRDDARLTAALGEASADLLAYLQRRVGLDDAPDLLGETMVVAWRRVREL
51 PVEPERARMWLFGIARGTVLNHARGERRRWALADRIRLDASQRTASPAAD
101 EGADVRDAIARLEPDLAELVRLVHWERFTIAEAAEVLGVAASTARGRYAK
151 AKDALRAALGVEAVAPHP

>ECFp89599 ECF218 ECF218s29 Demequina globuliformis

1 MTEVVRALDANSADLLAYLERRLGVHDAPDVLSEVMTVAWRRAADLPADP
51 EQARMWLFGIAKGALANARRGEVRRANLADRLRAISFERANVSAPADTGL
101 TTRECIDALPAQLAEVIRLVHWEGFSLAEIAQLEQVSPSTVRSRYARAKE
151 LLREMLDESIATVTPLRRAAVL

>ECFp177757 ECF218 ECF218s29 Microbacterium sp. 69-10

1 MTPSVEPLTRALESSASDLLAYLERRVGADDAPDLLGETMVVAWRRVKEL
51 PSDDERARMWLFGIARGTLLNHSRGQRRRWALADRIRLQVRESATAPPAD
101 EGAEVRDAIDRLEPELAELVRLVHWERLSVADAAGLLGIPASTARGRYQR
151 AKDQLRAALRQAAALP

>ECFp163557 ECF218 ECF218s29 Agromyces cerinus subsp. cerinus

1 MAEASPDLLAYFERRVGADGADLLAETMLIAWRRRSELPREVEPARMWLF
51 GVARNVLRNAARSELRRERLGGALREVLTARQVEDPADVVAMRDLLERLD
101 PDLAEIVTLVHWDGWSLVEIGRLLGMPASTVRGRYQRAKEELRAQLAVRA
151 PR

Name Aliases LCA Taxa Group Subgroup
ECFp156113
  • RNA polymerase subunit sigma-24
  • BN1193_RS09525
Microbacterium gorillae ECF218 ECF218s29

>ECFp156113 ECF218 ECF218s29 Microbacterium gorillae

1 MPKAGADHLTGVLRANALDVLRYLQRRVGLDDAADLLSETMMIAWRRVTD
51 LPGEDVAARMWMFGIARGTLLNHARGERRRVALADRVRHEARAATAPPSD
101 TGTEVRDAIARLDPDLAELVRLVHWDGFSVAQAAELLGIPAPTARGRYAR
151 AKEQLRAALTETVPGGASRG

>ECFp156107 ECF218 ECF218s29 Cryobacterium levicorallinum

1 MSAVRRARDERLTNALDQNARDLLRYLERRVGSNDAPDALSDTMIAAWKG
51 AARVPTNPVEARMWMFGIARNVVLNHSRGERRRSRLAERLRESVGVLPAN
101 NDAAAGLDVLDAIQRLDPDLAEVIRAVHWDGFSLAEISQYLGLPASTVRS
151 RYHRAKRELAHVLGSQVELIQ

>ECFp156064 ECF218 ECF218s29 Cryobacterium luteum

1 MNARQKGKQLTKVLDQCAGDVLRYLQRRVGPDDAADLLGDTMMVAWRRVN
51 LLPADAEGARMWIFGLARGTLLNHSRGERRRLALSEKIRTHVMSARTAPA
101 ADEGSDVRDALSQLSPELREIVQLVHWEGFTLAQAAQVVGIPAPTARGRY
151 KRAKDELRVALGVIV

>ECFp136074 ECF218 ECF218s29 Frigoribacterium sp. Leaf263

1 MGSRKRALRSALEASSVDLLSYLRRRTDSDEAPDLLGETFVVAWRRLDDL
51 PEEPEQARMWLFGIARGVLLNHARGVHRRWALADRLRGHAVLAPVTAPPA
101 DEHLDVRDAISRLEPDMAELVRLVHWDGFTITDATQVMGIPASTARGRYQ
151 RAKELLRVALDPAVAP

>ECFp136011 ECF218 ECF218s29 Microbacterium sp. Leaf161

1 MSRDAALTRVLEESATDLLAYLSRRVGPDDAADLLGETMVIAWRRSSDLP
51 DEPERSRMWLFGIARGTLANHGRGQRRRWALADRLRLLRQEDHSSPAADE
101 GLEVRDAIARLDPDLAEIVRLVHWDRLSLVHAAQLLGIPSSTARGRYARA
151 RELLRAELAVGAAPNAENGAGFA

Name Aliases LCA Taxa Group Subgroup
ECFp136014
  • hypothetical protein
  • ASG06_07770
  • ... more
Rathayibacter ECF218 ECF218s29

>ECFp136014 ECF218 ECF218s29 Rathayibacter

1 MSRRDARADRVVVILDATARDLLRYLERRVGADDAPDALSETMTIAWRRS
51 SAMPRHDDEARLWLFGVARNVVLTTSRTRRRRDLLAERLRGTIDPASVIE
101 QPSDLVLDVRAALDRLAPELAELVRLVHWDGFSLAEAAVIVGVPPSTARS
151 RYARAKRDLGELLSPLAPEGALGTAERR

Name Aliases LCA Taxa Group Subgroup
ECFp135969
  • RNA polymerase subunit sigma-24
  • ASD93_07140
  • ... more
Microbacterium sp. Root180 ECF218 ECF218s29

>ECFp135969 ECF218 ECF218s29 Microbacterium sp. Root180

1 MSRDDRRLTAALSAASPDLLAYLQRRVGPDDAPDLLGETMVVAWRRVADL
51 PDDAERVRMWLFGIARGTLLNHARGERRRWALADRIRVTVADVTAPAADE
101 GVEVRDAIARLGADDAELVRLVHWERMTLVQAAELLGIPDSTARTRYARV
151 KEQLRTALGAPAGV

>ECFp135929 ECF218 ECF218s29 Microbacterium sp. SA39

1 MSRTEEPLTRVLMHSSGDILNYLARRVGHDDAPDLLGETMVVAWRRVREL
51 PDDPERARMWLFGIARGTLQNHARGERRRWALADRIRLHARTEASSPASD
101 AGSEVRDAFARLDPDLAELVRLVHWDGFSLTDAAELLGIPASTARGRYQR
151 AKSDLRAALSMEAPLA

>ECFp135850 ECF218 ECF218s29 Microbacterium sp. Root322

1 MRTQKLLTAALRESNGDILRYLQRRVGPVDAPDLFGETLLIAWRRVDDLP
51 ENPLEMRMWLFGLARGTLQNHARGERRRAALADRIRAHMPRASDTPAADE
101 GDEVRDALSRLRPELAEIVQLVHWDGFRIGEAAEIVGVPAATARSRYARA
151 KQELRAALGALA

>ECFp135842 ECF218 ECF218s29 Microbacterium oleivorans

1 MTRALDAALAAASPSLLAYLQRRVGFDDAPDLLGETMVAAWRRVGDLPSD
51 PERARMWLFGIARGTLLNHARGERRRWALADRIRRSTAAEATSRAADDGA
101 EVRDAIARLDPDRAELVRLLHWDGFTLVEAAELLGVPSSTARSRYAKAKE
151 ELRASLGAMSEAPR

Name Aliases LCA Taxa Group Subgroup
ECFp135814
  • RNA polymerase subunit sigma-24
  • ECF RNA polymerase sigma factor SigL
  • ... more
Microbacterium hydrocarbonoxydans ECF218 ECF218s29

>ECFp135814 ECF218 ECF218s29 Microbacterium hydrocarbonoxydans

1 MTAEAARLTAAVEANAADLLAYLSRRVGPDDAPDLLGETMVVAWRRVREL
51 PTGIERARMWLFGIARGTLLNHARGQRRRWALADRIRLEPAADQSGAPAD
101 AGAEVRDAIARLDPEQAELVRLVHWDGLSVAEAAELLGIPASTARGRHQR
151 AKDDLRAALSIEAPLA

>ECFp135730 ECF218 ECF218s29 Microbacterium sp. MEJ108Y

1 MSRDAALTRVLEESATDLLAYLSRRVGPDDAADLLGETMVIAWRRSSDLP
51 DEPERARMWVFGIARGTLANHDRGQRRRWALADRLRLQRQEHHSSPAADE
101 GLEVRDAIARLDPDLAEIVRLVHWDRLSLVHAAELLGIPSSTARGRYARA
151 RELLRAELAVGAAPNAENGAGFA

Name Aliases LCA Taxa Group Subgroup
ECFp135710
  • RNA polymerase subunit sigma-24
  • ASD65_03365
  • ... more
Microbacterium sp. Root61 ECF218 ECF218s29

>ECFp135710 ECF218 ECF218s29 Microbacterium sp. Root61

1 MTRSHAALEAALAASSTDLLAYLQRRVGPVDAPDLLGETMIVAWRRAGEV
51 PTEPERARMWLFGIARGTLLNHARGERRRWALADRIRGHVDADAAAPGSD
101 EGLEVRDAIARLDPDLAELVRLVHWERLSLVDAAELLGIPASTARGRYAR
151 AKEELRVALGATASTP

>ECFp135667 ECF218 ECF218s29 Demequina sediminicola

1 MGDVLKALDANSADLLQYLERRIGITDAPDVLSDVMTIAWRRTGDVPDDP
51 EQARMWLFGIAKRSLANAHRGEVRRANLADRLRWLAYDQGPVAPAADDGL
101 TTRDCIAALPEPLAEIVRLVHWDGLTLAEVAQLEEVAPSTVRSRYARAKE
151 MLRAMLEEEPLASVARLKQRTG

Name Aliases LCA Taxa Group Subgroup
ECFp135633
Demequina aestuarii ECF218 ECF218s29

>ECFp135633 ECF218 ECF218s29 Demequina aestuarii

1 MSRVSERLEAAVRANSDDLLAYLERRVGIDDAPDTLAEVMTVAWRRAKHL
51 PTLPVEARMWLFGIARNVVSNAARTRIRRTRLADRLREVASAASMPAADD
101 GVEVREAIAALDTDLSEIVRLRHWEGFSLAEIASILDEPASTVRSRYAKA
151 RDLLATALADAEPQATPRLR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more