ECF proteins of ECF subgroup ECF218s1

Displaying ECF 1 - 20 of 362 in total
Name Aliases LCA Taxa Group Subgroup
ECFp3879
  • RNA polymerase subunit sigma-70
  • OP79_RS19155
Streptomyces yerevanensis ECF218 ECF218s1

>ECFp3879 ECF218 ECF218s1 Streptomyces yerevanensis

1 MEGVDTTLRKRISTGDQGAFGELFDAYARSVYNHAFRLTGNWAQAEDVVS
51 LTFLDAWRLREKVNEEGGSLRPWLLGIATNVTRNTRRAARRHAAAVARLP
101 RGEVERDFADEIAGRLDDSAQLALVRTALSELRRADREVLAICVWAGLDY
151 AAAAEALGVPVGTVRSRLSRARTKLAKYMEPPAGRGQMRDDRTTAVRPIK
201 EGNR

>ECFp3732 ECF218 ECF218s1 Streptomyces sparsogenes

1 METKPRTRIRDGDPDAFGELFDACARSVHNHAYRLTGDWSTAEDMVSLTF
51 LEAWRLRGRIDAEGGSLRPWLLGIATNTVRNARRAARRHAVALSRLPRQE
101 PVRDFADDVASRIDDTDLLASVTTALEALRRPEREVLALCVWSGLDYAAA
151 AEALGVPVGTVRSRLSRARKKLAAATEKTTKTEKAADRNREPARRRAQVR
201 DGRTPAARPIEEGNR

>ECFp177125 ECF218 ECF218s1 Nonomuraea jiangxiensis

1 MSMRVRIRDGDKAAFGQLFDECSKSVYNHAFRLTGNWSTAEDVTALTFLE
51 AWRLRGRIDVEGGSLRPWLLGIATNVVRNQRRAARRHDDALARLPPGEQV
101 PDFADEVVGRIDDAERLATVRRAYGRLRRQEQDVFALCVWAGLDYAQAAE
151 ALGIPVGTVRSRLSRARRKLANFGEPPPGTRQVEGDRGPEEMKEVR

>ECFp4180 ECF218 ECF218s1 Streptomyces exfoliatus DSM 41693

1 MDMSVRARIRAGDSDAFGSLFDDYARAVHNHAFRLTGDWSAAEDVLSLTF
51 LEAWRLRASVDPDGGSLRPWLLGIATNVVRNTRRAARRHEAAMNRLPREE
101 VFPDFADDLVGRIDDAERVAALQAALSRLRRPEREVVALCVWSGLDYAAA
151 AKALDIPVGTVRSRLSRARKKLLKYAGPGFSSPNGNSDPGRGQIDGDRVP
201 AVRPTQEEAR

>ECFp4240 ECF218 ECF218s1 Kitasatospora griseola

1 MITDMRTRVRAGDPSVFGELFDRYARAVYNHAFRLTADWSVAEDVMSATF
51 MEAWRLRGRVAEEGGSLRPWLLGVATNLARNHCRSNRRYRAAAAALAASG
101 ASVVEVPDHAEEVVGQVDDRRRLAATMAAMGALRRAEREVLVLCLWDGLE
151 YAEAAEALGIPVGTVRSRLSRARTKLRKLVDSELAAEKREPARRPRQMNG
201 DRATAVRPVPEGHR

Name Aliases LCA Taxa Group Subgroup
ECFp3941
Streptomyces niveus ECF218 ECF218s1

>ECFp3941 ECF218 ECF218s1 Streptomyces niveus

1 MTTELRARIRDGDPDAFAEIFDSYARAVYNHAYRLTADWSVAEDVMSETF
51 MAAWRMRERADADGGSLRPWLLGVATNVARNHLRSNRRYRAAATAAATDA
101 ERGALETPDHAGLVAGQLDDRRRLAATMRALASLKPLEREVLVLCLWEGM
151 RYDDAATALGIPVGTVRSRLSRARKKLARRADAELDAGKGVAGKLVAGKR
201 EPVAPTRQVRGDRATAVRSAREGNR

>ECFp3626 ECF218 ECF218s1 Streptomyces sp. NRRL S-495

1 MELSQRGRIRNGDQWAFGELFDQAADDLYRYAVRVSGDWAVAEDIVQLTF
51 LEAWRLRHKLRESDEPVRPWLFGVAANVLRNTTRAARRHRAAMERLPPRD
101 VVPDFADELVGRLDDSAQLAAARRALERLRKAEREVFGLCVWAGLDYASA
151 AEALGVPIGTVRSRLSRARTKLRALAEEELRKGRELRPEPGQVRVGRTDA
201 ARSTRETNR

>ECFp3575 ECF218 ECF218s1 Streptomyces europaeiscabiei

1 MHARIRAGDPDAFRELFRDHAQLVFRHAVRTTGDWGAAEDVVSLTFLEAW
51 RLRGKLRDEGESPRPWLMGIAVNVLRNTGRAARRHERALARVPLRDVLPD
101 FADELVGRITDSGELAAAKRALGQLRRAEREVFALCVWSGLGYAEAAEAL
151 GVPVGTVRSRLSRARARLRKLTDSELRRRGGGTEPGGSGGQVQGGRTAAA
201 RSNEERTR

>ECFp3535 ECF218 ECF218s1 Streptomyces albus subsp. albus

1 MHARIRAGDPDAFRELFRDHAQLVYRHAVRTTGDWSAAEDIVSLTFLEAW
51 RLRGKLRDEGASPRPWLMGIAVNVLRNTGRAARRHERALARVPLRNALPD
101 FADELVGRIADSDELAAAKVALGKLRRAEREVFALCVWSGLGYAEAAEAL
151 GVPVGTVRSRLSRARARLRSLTDSELRRRGGGAEPLGAGGQVQGGRTTAA
201 RSNEERNR

>ECFp177169 ECF218 ECF218s1 Streptomyces sp. WAC00263

1 MDYSLHTRIRAGDPEAFRELFRDHARLVHRHAVRVTGDWTVAEDIVSLTF
51 LEAWRLRVKLRDEGDSPRPWLMGIAVNVLRNTTRAARRHQRALERLPAKE
101 KVPDFADELVGRIADADQLAAAQRVLKKLNRSEREVFTLCVWSGLSYAET
151 AAVPGVPVGTVRSRLSRARKRLSKLADEELRKRTEPLPRNGQVQGGRTSA
201 ARSHEAYEERSE

Name Aliases LCA Taxa Group Subgroup
ECFp177072
  • RNA polymerase
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Streptomyces griseus ECF218 ECF218s1

>ECFp177072 ECF218 ECF218s1 Streptomyces griseus

1 MLAVMRVTGTPPGARTSQGVNYSMHARVRAGDPDAFRELFRDHAQLVFRH
51 AVRTTGDWSAAEDVVSLTFLEAWRLRGKLRDEGESLRPWLMGIAVNVLRN
101 TGRAARRHERALARVPLRDVLPDFADELVGRIADSDELAAAKSALGQLRR
151 AEREVFALCVWSGLGYAEAAEALGVPVGTVRSRLSRARTRLRSLTDSELR
201 RRGGGGREPRRAEPGIGGAEPGAGGARPGSAQPEGTEPDGSGGQVQGGRT
251 AAARSNEERSR

>ECFp177086 ECF218 ECF218s1 Streptomyces sp. TSRI0395

1 MHARIRAGDPDAFRELFRDHAQLVFRHAVRTTGDWSAAEDVVSLTFLEAW
51 RLRGKLRDEGESPRPWLMGIAVNVLRNTGRAARRHERALARVPLRDVLPD
101 FADELVGRITDSGELAAAKRALGQLRRAEREVFALCVWSGLGYAEAAEAL
151 GVPVGTVRSRLSRARARLRKLTDSELRRRGGGTEPGRSGGQVQGGRTAAA
201 RSNEERTR

>ECFp177095 ECF218 ECF218s1 Streptomyces sp. CB02056

1 MEQSIRARIRAGDAEAFGQVFEDHAQAVYRHAVRMTGDRTVAEDVVSLTF
51 LEAWRLRARIAPEREDGAESLAPWLLGIAGNVIRNTRRAARRHQKAMAKL
101 PPREVVPDFSGELAGRIADAEELAAAKAALERLRPAEREVFALYVWEGLD
151 HAAVAEALGCPVGTVRSRLSRARARLRELTERELAAARSARAEQRGAPAA
201 EQPGTPRPGQRAGHRAAETAQRPGSTGQVPGDRTPAVRPTKETIR

>ECFp136883 ECF218 ECF218s1 Streptomyces sp. OspMP-M43

1 MLAVMRVTGTRPGARTSQGVNYSMHARVRAGDPDAFRELFRDHAQLVFRH
51 AVRTTGDWSAAEDVVSLTFLEAWRLRGKLRDEGESLRPWLMGIAVNVLRN
101 TGRAARRHERALARVPLRDVLPDFADELVGRIADSDELAAAKSALGQLRR
151 AEREVFALCVWSGLGYAEAAEALGVPVGTVRSRLSRARTRLRSLTDSELR
201 RRGGGREPRRAEPGTGGAEPGAGGARPGSAQPEGTEPDGSGGQVQGGRTA
251 AARSNEERSR

>ECFp136886 ECF218 ECF218s1 Streptomyces sp. MnatMP-M77

1 MLAVMRVTGTRPGARTSQGVNYSMHARVRAGDPDAFRELFRDHAQLVFRH
51 AVRTTGDWSAAEDVVSLTFLEAWRLRGKLRDEGESLRPWLMGIAVNVLRN
101 TGRAARRHERALARVPLRDVLPDFADELVGRIADSDELAAAKSALGKLRR
151 AEREVFALCVWSGLGYAEAAEALGVPVGTVRSRLSRARTRLRSLTDSELR
201 RRGGGGREPRRAEPGTGGAEPGAGGARPGSAQPEGTEPDGSGGQVQGGRT
251 AAARSNEERSR

>ECFp3979 ECF218 ECF218s1 Streptomyces sp. CNB091

1 MHARIRAGDPDAFRELFRDHAQLVFRHAVRTTGDWSAAEDVVSLTFLEAW
51 RLREKLRDEGESPRPWLMGIAVNVLRNTGRAARRHERALARVPLRDVLPD
101 FADELVGRIADSDELAAAKRALGQLRRAEREVFALCVWAGLGYAEAAVAL
151 GVPVGTVRSWLSRARARLRKLTDSELRRRGGGAEPRRTEPGREEPRRTEP
201 RRAASRRTEPDGMEPGGTGGQVQGGRITAARSNEERTR

>ECFp3971 ECF218 ECF218s1 Streptomyces antibioticus

1 MDYSLHTRIRAGDPEAFRELFRDHASLVHRHAVRVTGDWAVAEDIVSLTF
51 LEAWRLRVKLRDEGDSPRPWLMGIAVNVLRNTTRAARRHQRALERVPAKE
101 TVRDFADELVGRIAAADQLAAAQRVLKKLSRSEREVFTLCVWSGLSYAET
151 AAVLGVPVGTVRSRLSRARARLTKLVDEEMRKRTEPLPRNGQVQGGRTSA
201 ARSHESYKERSE

>ECFp177075 ECF218 ECF218s1 Streptomyces sp. Ag109_O5-10

1 MDYSLHTRIRAGDPEAFRELFRDHARLVHRHAVRVTGDWSGAEDIVSLTF
51 LEAWRLRAKLRDEGDSPRPWLMGIAVNVLRNTTRAARRHQRALQRLPARE
101 TVPDFADALVGRMADADELAAAQRALRKMNRSEREVFTLCVWSGLGYAEA
151 AAALGVPVGTVRSRLSRARRRLSRLAEEELRRRREPPPRNGQVQGGRGSA
201 ARSHESYEERSE

>ECFp177087 ECF218 ECF218s1 Kitasatospora sp. CB01950

1 MNHPHSRLRAGNPEAFRDLFRDHSSLVYRHAVRVTGNWALAEDVVSLTFL
51 EAWRLRGKLRDEGDSPRPWLMGIAVNVLRNTTRAARRHSAAMARMPAADV
101 VPDFADELVGRMADSEELAAARKALARLRRSEREVFALCVWSGLGYAEAA
151 ATLGVPVGTVRSRLSRARTRLRRLADEELRAAKKKLEPLPIPGQVQGSRD
201 TAARPYKETHR

>ECFp177045 ECF218 ECF218s1 Actinoplanes derwentensis

1 MRRALGLCLAPSVRRALGLCLALLTHVASYRLYSRDFSLGSAGKSEGTRG
51 GERTVTGVTATMRARIRAGDADAFAEVFDEHAQAVYRHAVWTDGDHTNAD
101 DVVSLTFLEAWRIRETLRPDGDGLRPWLLGIATNVLRNRRRAARRHRAAL
151 ARVPERAGDRATVPDFADEVVGRLYDSAQLAAAAAALGALRRADREVFLL
201 CVWQELDYAAAAEALGIPIGTVRSRVSRARVRLRALAEAGLGRKRETTAP
251 ESTQEQLAPEAGSVHEQVTAEPEISRGPVPVPGAAARAGAGREWAARGWL
301 EGER

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more