ECF proteins of ECF subgroup ECF19s44

Displaying all 11 ECF

>ECFp148443 ECF19 ECF19s44 Curtobacterium

1 MWNVTVSAELHALRDEERALMTAVANGDRQAFTRLHARFRPLVERWVRHH
51 LVDPWQSEEVVQDVFLEVWQLADRYDPRWSVVAWLRTIAQRRAIDRVRTS
101 QADRQRDLRIGARTVELVDHASVERAEGVLDRIALHRAVRTLPPRQREAV
151 VLRHLSELSGPELAERLGVPLGTAKTRARDGVLTLRRCLTP

>ECFp165896 ECF19 ECF19s44 Curtobacterium sp. BH-2-1-1

1 MLLLAVAAGDRAAFTRLHDRFRPLVERYVRHQLVDAWQAEEVVQDVFLEI
51 WQIAGRFDPAHSAIAWIRTIAQRRAIDRVRKSRADRDRDLRIGTRDADLV
101 DHSSVERAESVLDRAELRRAVAALPGRQRDAVVLRHLVGMTGPEVAARLG
151 VPVGTAKTRARDGVIALRRVMVP

>ECFp91148 ECF19 ECF19s44 Curtobacterium sp. UCD-KPL2560

1 MWNVTVSAELHALRDEERALMTAVANGDRQAFTRLHARFRPLVERWVRHH
51 LVDPWQSEEVVQDVFLEVWQLADRYDPRWSVVAWLRTIAQRRAIDRVRTS
101 QADRQRDLRIGARSVELVDHASVERAEGVLDRIALHRAVRTLPPRQREAV
151 VLRHLSELSGPELAERLGVPLGTAKTRARDGVLTLRRCLTP

Name Aliases LCA Taxa Group Subgroup
ECFp91001
Curtobacterium sp. B8 ECF19 ECF19s44

>ECFp91001 ECF19 ECF19s44 Curtobacterium sp. B8

1 MLAVAGGDQAAFTALHRRLRPIVERYVRHQLTDPTQAEEVVQDVFLELWT
51 IAGRYDPSHSVIAWVRTIANRRAIDRVRKSVADRDRDLRIGARDHEPVDL
101 ASQERAESVLDRTALRRAIVRLPPRQREAVVLRHLVGLSGPELAAELGLP
151 LGTAKTRARDGVLTLRRTMASQRAAR

>ECFp86882 ECF19 ECF19s44 Curtobacterium sp. B18

1 MDDDLLAERDEERALLLAVAAGDRDAFTRLHQRFRPLVERYVRHQLVDPW
51 QAEEVVQDVFLELWQIADRFDPAHTAIAWIRTIAHRRAIDRVRKSRADRD
101 RDRRIGARDTELVDHASVERAESVLDRVALHRAVAALPGRQREAVVLRHL
151 VGMSGPELAERLGVPVGTAKTRARDGVVALRRVLVP

Name Aliases LCA Taxa Group Subgroup
ECFp79101
  • hypothetical protein
  • NS263_01335
  • ... more
Curtobacterium oceanosedimentum ECF19 ECF19s44

>ECFp79101 ECF19 ECF19s44 Curtobacterium oceanosedimentum

1 MWNVTVYDDLLLRRDEERHLLLDVAAGDRAAFRRLHDRFRPLVEHWVRNH
51 VVDRWQSEEVVQDVLLELWRLADRYDPRHPPVSWIRTIAQRRAIDRVRKA
101 EADRQRDARVGARYADAVDHASVERAEGVLERESLRRAVAALPPRQREAV
151 VLRHLAELSGPELAERLGVPVGTAKTRARDGVQALRRSLGRSGVVDR

>ECFp161442 ECF19 ECF19s44 Curtobacterium sp. UNCCL20

1 MLLAVAAGDPRAFDRLYARFRSLVEHYVRHQLVDPWQAEEVVQDVFLEIW
51 RIADRFDPQHSAIAWIRTIAQRRAIDRVRKSCADRDRDLRIGARDLDLVD
101 HSSTERAESVLDRAELRRAVRALPDRQREAVVLRYLVGMTGPEVAGSLGV
151 PVGTAKTRARDGVVALRRVMAP

>ECFp152626 ECF19 ECF19s44 Curtobacterium

1 MNDELLAKRDEERMLLLAVAAGDRAAFTRLHDRFRPLVERYVRHQLVDAW
51 QAEEVVQDVFLEIWQIADRFDPAHSAIAWIRTIAQRRAIDRVRKSRADRD
101 RDLRIGTRDADLVDHSSVERAESVLDRAELRRAVAALPGRQRDAVVLRHL
151 VGMTGPEVAARLGVPVGTAKTRARDGVIALRRVMVP

>ECFp149770 ECF19 ECF19s44 Curtobacterium sp. MCBA15_001

1 MTAVGRGDQTAYAELSVRYRPLIAHWVRRYLSDAWVVDEVTQDVLLELWT
51 IADRFDPARAVAPWVRTITQRRAIDRLRKLCTERERDLRIGARDLDVVDH
101 ASVERAESVLDRLALRRALRVLPARQREAVVLRHLVGLSGPELGVVLGVP
151 TGTARTRARDGVLALRRVMTAPSGTSP

>ECFp147619 ECF19 ECF19s44 Curtobacterium sp. MCBA15_008

1 MDDALLARRDEERALLLAVALGDRRAFERLYVRFRPLVERYVRHQLVDPW
51 QAEEVVQDVFLEIWQIADRFDPQHAAIAWIRTIAQRRAIDRVRKSSADRD
101 RDLRIGARDHEPVDHAGTERAESVLERAELHRAVAALPVRQREAVALRYL
151 VGMTGPEVATSLGVPVGTAKTRARDGVTALRRVMAP

>ECFp108826 ECF19 ECF19s44 Curtobacterium oceanosedimentum

1 MGCRSLDSRASELPIVRTGMWNVTVHDDLLHRRDEERQLLLDVAAGDRVA
51 FTRLHDRFRPLVEHWVRHHVVDRWQSEEVVQDVLLELWRIADRYDPRHPP
101 VSWIRTIAQRRAIDRVRKAEADRQRDARVGARYADAVDHASVERAEGVLE
151 RESLRRAVAALPERQREAVVFRHLVELSGPELAERLGVPVGTAKTRARDG
201 LQALRRSLGRSGVVDR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more