ECF proteins of ECF subgroup ECF19s38

Displaying all 14 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp98620
Serinicoccus sp. JLT9 ECF19 ECF19s38

>ECFp98620 ECF19 ECF19s38 Serinicoccus sp. JLT9

1 MSAGAGDDDGIVAGWVRGEQDALERAYRRWSGLVHGLSRRAVGPDDADDV
51 TQAVFVSAWRGRTTFDPQAGSLGAWLVGITRRRIADHLRVRRRQPVPTGL
101 PHDGADGAGWSQADTADLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLELPLGTVKTHTNRTLARLRTLLGGAG

Name Aliases LCA Taxa Group Subgroup
ECFp90514
  • RNA polymerase subunit sigma-24
  • K330_RS0107050
Ornithinimicrobium pekingense DSM 21552 ECF19 ECF19s38

>ECFp90514 ECF19 ECF19s38 Ornithinimicrobium pekingense DSM 21552

1 MSSAAQEEQLASAWAGGDESVVQHAYERWGGLVHGLARRAVGPADADDVT
51 QQVFLAAWRRRETYRHEEGPLGAWLVGITRRQIAEHLRTRHRAAEVPTAA
101 EELPGAASPAWSAADADDLLAIYEELERIGEPQRQIVLMAYVQDKTQREI
151 AEELDLPLGTVKTHTTRTMARLRTLVGGAR

Name Aliases LCA Taxa Group Subgroup
ECFp87731
  • ECF subfamily RNA polymerase sigma-24 subunit
  • GQY_RS16530
Serinicoccus profundi MCCC 1A05965 ECF19 ECF19s38

>ECFp87731 ECF19 ECF19s38 Serinicoccus profundi MCCC 1A05965

1 MTGAGDDDDDIATAWVRGERDALERAYRRWSGLVHGLARRAVGADGADDV
51 TQVVFVSAWRGRDTYDPSAGPLGAWLVGITRRRIVDELRSRQRQVPVADA
101 APEVSDAQAWTAADSTDLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLDLPLGTVKTHTNRTLARLRTLLGGAR

>ECFp85986 ECF19 ECF19s38 Agrococcus pavilionensis RW1

1 MSSEETVEAERLSRAFAHDPSPEALRQAYERWGGMVFAIACRAMAPHDAE
51 DVVQQTFVSVWRSRESYDPDAGPLGAWIVAIARRRIADHWRSRSASELAV
101 DPETLHGALEAGEGDPVSDAVENALTVQEELERLGEPARTIVRLAVVEDR
151 STAWIAERLAMPAGTVKSHLSRGLRRLRDRWEESHAASA

>ECFp97237 ECF19 ECF19s38 Serinicoccus chungangensis

1 MSVEDGDDDAIAAAWENTEPDALERAYRRWGGLVHGLARRAVGPDDADDV
51 TQAVFVSAWRGRATYDRASAPLGAWLVGITRRRIADQLRARQRQAPVAQE
101 QQDVPDDGAWTAADSTDLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLDLPLGTVKTHTNRTLARLRTLLGGAR

>ECFp168441 ECF19 ECF19s38 Serinicoccus sp. CNJ-927

1 MSGGADDDEGIAADWVQGEQDALERAYRRWSGLVHGLSRRAVGPDDADDV
51 TQAVFVSAWRGRATYDPQAGPLGAWLVGITRRRIADHLRTRRRHPVAEPS
101 PDEGVDSDGWSQADSADLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLNLPLGTVKTHTNRTLARLRTLLGGEG

>ECFp167975 ECF19 ECF19s38 Ornithinimicrobium sp. CNJ-824

1 MTDSAASDAAGPPAATTTEERLALEAWLDGDERGLELAYRRWGGMVHGLA
51 AKAVGPVEADDVTQQVFLSAWRGRDGFDPARGPLGAWLVGITRRRVADVV
101 RARPFTAEVPTTDDEMATADLTAWDAADSTDLITVYEELERIGEPQRTIL
151 LMAYVEDRTQKEIAELLDLPLGTVKTHMTRTLRRLRDRLGGEQ

Name Aliases LCA Taxa Group Subgroup
ECFp167757
Agrococcus carbonis ECF19 ECF19s38

>ECFp167757 ECF19 ECF19s38 Agrococcus carbonis

1 MISENDDVARLSAAFAADASPELLRAVYERWGGLVYAIACRAMPAHDAED
51 VVQQTFVSVWRSRESYDPAAGPLGAWIVAIARRRIADHWRARSRHELATE
101 PESLAAALERGEGDPVSEAVADALTVQEELERIGEPQRTIVRLAVLEDRP
151 ATWIAEQLTMPVGTVKSHLSRALRRLRDRWEETHAAPVE

>ECFp165970 ECF19 ECF19s38 Serinicoccus sp. CUA-874

1 MSGGADDDEGIAADWVQGEQDALERAYRRWSGLVHGLSRRAVGPDDADDV
51 TQAVFVSAWRGRATYDPQAGPLGAWLVGITRRRIADHLRTRRRHPVAEPS
101 PDEGVDSDGWSQADSADLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLDLPLGTVKTHTNRTLARLRTLLGGEG

>ECFp164887 ECF19 ECF19s38 Ornithinimicrobium sp. CNJ-824

1 MALEAWLDGDERGLELAYRRWGGMVHGLAAKAVGPVEADDVTQQVFLSAW
51 RGRDGFDPARGPLGAWLVGITRRRVADVVRARPFTAEVPTTDDEMATADL
101 TAWDAADSTDLITVYEELERIGEPQRTILLMAYVEDRTQKEIAELLDLPL
151 GTVKTHMTRTLRRLRDRLGGEQ

Name Aliases LCA Taxa Group Subgroup
ECFp149050
Agrococcus baldri ECF19 ECF19s38

>ECFp149050 ECF19 ECF19s38 Agrococcus baldri

1 MIARVFADGPAEDGLRLAYERWGGLVLALALRAMSRSDAEDVVQRTFVSA
51 WRSRDAYDPDAGPLGAWLVRIARRRIADHCRSSAVQRERTVAPEALFEQL
101 ETEGTDDVPVAVAEAIAVEEALASLGEPQGTIVRMAVLEDQPTAVIADTL
151 QMPVGTVKSHLSRSLRRLRDRWEGAHDAHLA

Name Aliases LCA Taxa Group Subgroup
ECFp111926
  • hypothetical protein
  • H508_RS15695
Agrococcus lahaulensis DSM 17612 ECF19 ECF19s38

>ECFp111926 ECF19 ECF19s38 Agrococcus lahaulensis DSM 17612

1 MSSEEAVEAERLSRAFAQDPSPEALRQAYERWGGMVYAIACRAMAPHDAE
51 DVVQQTFVSVWRSRDSYDPDAGPLGAWIVAIARRRIADHWRSRSASELAV
101 DPETLHGALEVGEGDPVSDAVEDALTVQEELERLGEPARTIVRLAVVEDR
151 STAWIAERLAMPAGTVKSHLSRGLRRLRDRWEESHAASA

Name Aliases LCA Taxa Group Subgroup
ECFp111194
  • RNA polymerase subunit sigma-24
  • K342_RS16840
Serinicoccus marinus DSM 15273 ECF19 ECF19s38

>ECFp111194 ECF19 ECF19s38 Serinicoccus marinus DSM 15273

1 MSGGADDDEGIAADWVQGEQDALERAYRRWSGLVHGLSRRAVGPDDADDV
51 TQAVFVSAWRGRATYDPQAGPLGAWLVGITRRRIADHLRTRRRHPVAEMS
101 PDEGADSAGWSQADSADLLTIYEELERIGDPQRRIILLAYVEDLTQREIA
151 ERLDLPLGTVKTHTNRTLARLRTLLGGEG

Name Aliases LCA Taxa Group Subgroup
ECFp165726
Agrococcus jejuensis ECF19 ECF19s38

>ECFp165726 ECF19 ECF19s38 Agrococcus jejuensis

1 MTATEGFDDDAIALAFATGPSDVGLRLAYDRWGGLVLALALRVMDRADAE
51 DVVQQTFVSAWRSRERYDPEAGPLGAWIVRIARRRIADHFRVASVLHERV
101 VDPTVVLDRAERPHPVDVPDAVAGSILVEQTLAEMDEPQRTIVRLAVIED
151 LPASAIAERLELPVGTVKSHLSRTLRRLRDRWEGAHAAHLA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more