ECF proteins of ECF subgroup ECF19s36

Displaying all 15 ECF

>ECFp44740 ECF19 ECF19s36 Acidobacteriales

1 MYRESQIVNPPPPSVPDDAALLALVRNGDEYAMASLFDRYSKIVYSVALR
51 VLRDPAAAEDVLQEIFMQVWRNPDRFVASRGSLGGWLAVVSRNRSIDALR
101 RKRPTEDIDDIAPASDYNLADEAERNNMMEKARGVIQQLPAEQRKTLEMA
151 FFDGLTHSEIAEMTGDPLGTVKTRIRSALTTLRKAFTA

Name Aliases LCA Taxa Group Subgroup
ECFp43765
  • RNA polymerase subunit sigma-24
  • Q363_RS11595
Edaphobacter aggregans DSM 19364 ECF19 ECF19s36

>ECFp43765 ECF19 ECF19s36 Edaphobacter aggregans DSM 19364

1 MYREMGLANASPQSPQDDAALLALVRRGDEHAMASLFDRYSRVVYSVALR
51 VLRDPASAEDILQEVFIQIWRSPEGFIAVRGSLGGWLTVVARNRSIDALR
101 RKRPSETIDDLSLASQYDLANEAERNTMVERARGVMAKLPVEQRKTLEMA
151 FFDGLTHTEIAEMTGDPLGTVKTRIRSALMTLRKAFLA

Name Aliases LCA Taxa Group Subgroup
ECFp41814
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • AciX8_2494
Granulicella mallensis MP5ACTX8 ECF19 ECF19s36

>ECFp41814 ECF19 ECF19s36 Granulicella mallensis MP5ACTX8

1 MIEKSSNPIRAAERSLNSDLDRLQAANDEFLLERVRANDQKAMADIFDRY
51 GSLVYSVSLRVLKDPGQAEDVMQEIFFQLWKNPNTFVQGRGSLGAWLAVV
101 ARNRAIDVLRRRKPTDSVDEVVLVSKTNISSEIERNIMVEKIRELMKSLP
151 SEQQKSVELAFFEGLSHAEVAAKTGDPLGTVKTRIRLALISLRKAIQA

Name Aliases LCA Taxa Group Subgroup
ECFp40623
  • RNA polymerase subunit sigma-24
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Terriglobus roseus DSM 18391 ECF19 ECF19s36

>ECFp40623 ECF19 ECF19s36 Terriglobus roseus DSM 18391

1 MPPSDFSFGDITPRPNPQEPFARSFVRESEMTPSNDDGILLRAIQRGDEG
51 AMATIFDRYSRVVYSVALRVLRDPAAAEDVLQDIFMQIWRKPESFVSTRG
101 SLGGWLAVVARNRSIDSLRRRKPSDSVEDIVLASPFNLAEDSERTVMMER
151 ARGVITGLPAEQRKVIEMAFFDGLTHSEIAELTGDPLGTVKTRIRSALLV
201 LRKAMQA

Name Aliases LCA Taxa Group Subgroup
ECFp40492
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Granulicella tundricola MP5ACTX9 ECF19 ECF19s36

>ECFp40492 ECF19 ECF19s36 Granulicella tundricola MP5ACTX9

1 MPPPSLLDDAALLSQVQRGDEAAMASLFDRYSKVVYSVALRVLRDPAAAE
51 DVLQEIFMQIWRTPDGFIATRGSLGGWLAVVSRNRSIDALRRKRPSEQVD
101 DLGLASSYDLADEAERNSLIEKARGVIHLLPPEQRKTIEMAFFDGLTHSE
151 IAEMTGDPLGTVKTRIRSALQTLRKAFQS

Name Aliases LCA Taxa Group Subgroup
ECFp37646
  • RNA polymerase subunit sigma-24
  • G003_RS0114775
Acidobacteriaceae bacterium KBS 89 ECF19 ECF19s36

>ECFp37646 ECF19 ECF19s36 Acidobacteriaceae bacterium KBS 89

1 MYRETELVNSPPPSGLDDASLLSLVQRGDESAMASLFDRYSKVVYSVALR
51 VLRDPASAEDVLQEVFMQIWRNPDGFVATRGSLGGWLAVVARNRSIDALR
101 RKRPTEQVDDMALASNYNLADEAERNSLMEKARGVIQLLPVEQRKTLEMA
151 FFDGLTHSEIAEMTGDPLGTVKTRIRSALTSLRKAFTA

Name Aliases LCA Taxa Group Subgroup
ECFp37123
  • RNA polymerase subunit sigma-24
  • ACIX8_RS12405
Granulicella mallensis MP5ACTX8 ECF19 ECF19s36

>ECFp37123 ECF19 ECF19s36 Granulicella mallensis MP5ACTX8

1 MLERVRANDQKAMADIFDRYGSLVYSVSLRVLKDPGQAEDVMQEIFFQLW
51 KNPNTFVQGRGSLGAWLAVVARNRAIDVLRRRKPTDSVDEVVLVSKTNIS
101 SEIERNIMVEKIRELMKSLPSEQQKSVELAFFEGLSHAEVAAKTGDPLGT
151 VKTRIRLALISLRKAIQA

Name Aliases LCA Taxa Group Subgroup
ECFp168427
Terriglobus roseus ECF19 ECF19s36

>ECFp168427 ECF19 ECF19s36 Terriglobus roseus

1 MRIRIQFWKRTPTEDALTSSTPMASSEFSFGNITPRPNPAEPFARSFARE
51 SEVLPASDDNFLLRGVQRGDEAAIAQLFDRYSKLVYSVALRVLRDPSAAE
101 DVLHETFLNLWSQSESYNDATTSLGGWLAVSARNRSLDTLRRKKTDAKVE
151 EFQLPAAVRLAEEADRTATLERTRAALLRLPAEQRKALDMAYFDGLTHTE
201 IAELTSEPAATVKTRIRTGFLQLRKAMQL

Name Aliases LCA Taxa Group Subgroup
ECFp166430
Terriglobus roseus ECF19 ECF19s36

>ECFp166430 ECF19 ECF19s36 Terriglobus roseus

1 MAPSSDDGLLLRAIQRGDEGAMATIFDRYSRVVYSVALRVLRDPAAAEDV
51 LQDIFMQIWRKPESFVSTRGSLGGWLSVVARNRSIDALRRRKPSDSVEDV
101 VLASPFNLADDSERTVMMERARGVIIGLPVEQRKVIEMAFFDGLTHSEIA
151 ELTGDPLGTVKTRIRTALLVLRKAMHA

Name Aliases LCA Taxa Group Subgroup
ECFp1472
  • RNA polymerase subunit sigma-24
  • sigma-24, ECF subfamily
  • ... more
Candidatus Koribacter versatilis Ellin345 ECF19 ECF19s36

>ECFp1472 ECF19 ECF19s36 Candidatus Koribacter versatilis Ellin345

1 MVLIARVRGGDQSSMAVIYDRYSPIVYAAALRILGDAAAAEDVLQEIFMQ
51 LWRNPAAFDASRGNLAAWLGVIARHRAIDVLRKRKPQTDFEDVVIASTYD
101 LRKEAEQNAIVEKVRAALAEMFPEQRRCMEMAYFEGLTHSEIAAKTGEPL
151 GTIKTRIRSALIQLRKKLGGAGESS

>ECFp142020 ECF19 ECF19s36 Granulicella pectinivorans

1 MYRETGMQGLPDASTRDDASLLALVQRGDEQAMASLFDRYSKVVYSVALR
51 VLRDPASAEDILQEIFMQVWRHPESFIATRGSLGGWLAVVSRNRSIDQLR
101 RKKPTDSVDDVALASPYNLADEAERNNMMERARAVIHLLPKEQRKTLEMA
151 FFDGLTHSEIAEMTGDPLGTVKTRIRSALLSLRKAFQA

Name Aliases LCA Taxa Group Subgroup
ECFp106527
  • RNA polymerase subunit sigma-24
  • VO84_RS07095
Terracidiphilus gabretensis ECF19 ECF19s36

>ECFp106527 ECF19 ECF19s36 Terracidiphilus gabretensis

1 MMDGVRSKDQAAMAEIFDRYAGLVYSISLRVLNDQGYAEDVMQQIFFEVW
51 ERPQSFVPGRGSLAGWLSVVARNRAIDHLRRGKPSDSIDEVVLPAQSNLS
101 VEAERRLMMEKVRTRLELLPKDQQESLELAFFEGLSHSEIAAQTGIPLGT
151 IKTRIRSALHLLREAVQA

Name Aliases LCA Taxa Group Subgroup
ECFp112084
  • RNA polymerase subunit sigma-24
  • Q363_RS33960
Edaphobacter aggregans DSM 19364 ECF19 ECF19s36

>ECFp112084 ECF19 ECF19s36 Edaphobacter aggregans DSM 19364

1 MDGVQADGDDAVLIARTRQRDQDAFARLYDRYSPLVYSVALRVLRNPSAA
51 EDVLHDIFLQLWRSPEKFDSARGNFASWLAVIARNRAIDGTRRERPRIDP
101 EEVVLISPANIETEAERNAVAEKIRNMLKEMPAAQRSAVEMAFFDGMTHG
151 EIAAATQEPLGTIKTRIRSALMTIRKAYER

Name Aliases LCA Taxa Group Subgroup
ECFp104305
  • RNA polymerase subunit sigma-24
  • N547_RS0108565
Acidobacteriaceae bacterium URHE0068 ECF19 ECF19s36

>ECFp104305 ECF19 ECF19s36 Acidobacteriaceae bacterium URHE0068

1 MSFGTHESGSGSDTSLIDRVRVGEQQAMTEIFDRYAGLVYSVALRVLRDS
51 GHAEDVTQDIFFQLWRNPGSFSASRGSLGAWLLVIARNRAIDHLRQRRPG
101 EALDEVIVASATNLHNEAERSIIIQRVKVMIGDLPEEQQQSLQMAFFEGL
151 SHSEIAEKTRQPLGTVKTRIRSALTSLRKRLEP

Name Aliases LCA Taxa Group Subgroup
ECFp100363
  • hypothetical protein
  • G002_RS0113425
Acidobacteriaceae bacterium KBS 83 ECF19 ECF19s36

>ECFp100363 ECF19 ECF19s36 Acidobacteriaceae bacterium KBS 83

1 MLTRIGQRDENAMEAVFRRYSGPVYSVAFRVLRDSGQAEDVLQEVFLQLW
51 RKPAAFVQNRGSLGAWLVVIARNRAIDVLRRRKPSSSVEDVVLASPVNVA
101 DEAERNTVMQKVRGVIANLPEEQRKTLQLAYFEGFSHTEIASRTGDPLGT
151 VKTRIRQALITLRKALEA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more