ECF proteins of ECF subgroup ECF19s28

Displaying all 20 ECF

>ECFp171421 ECF19 ECF19s28 Leptolyngbya sp. 'hensonii'

1 MNPDLDSGAGPTLLPADIELIRDLKARKADALGLIYDRYASLVYRLALRI
51 LLEAQEAEDLTQEVFLYLWQSQTYNPDRGSLGSFLTTMTRSRAIDRLRSR
101 NHKLKVLQQLGQTMATETPPITPFEAASLQQRSHYVQDALLQLPEKQRQI
151 LELAYYNGLSQSEIAAQLGLPLGTVKTWSRQGLLSLRKHLQTWID

>ECFp171411 ECF19 ECF19s28 Cyanobacteria bacterium 13_1_40CM_2_61_4

1 MRPTGTDEAASPEPSDEVLLRALATDRAALGPLYDRYGGLVYGLARAILE
51 SPAEAEDLTQEVFVMLCERTTYDPARGSLGAFLTTLTRSRAIDRLRSRGR
101 RLRILRATWRSAPPPDLGSPPVERIATRECAERVRGALAGLPADQRRALE
151 LVYYQGLTQAEIAATLDAPLGTVKSWCRRGLLGLRAALADLVE

>ECFp9742 ECF19 ECF19s28 Phormidium willei BDU 130791

1 MSVTDVDLYEQLQTGDRTALGQLYDRYGGLVYGVSLKVLGNPQEAEDLTQ
51 EIFLILWRKQNYDPSRGKLSTFLMMLTRSRAIDRLRSRGRNRKFLGRWGA
101 TLSEDTMTTHTPFDEISLSERRDTVRQALDQLPEKYRSILELAYYQGMSQ
151 SAIADHLKMPLGTVKTRSRKGLLELREHLQEWMG

Name Aliases LCA Taxa Group Subgroup
ECFp9688
  • RNA polymerase sigma factor
  • UH38_09480
  • ... more
Aliterella atlantica CENA595 ECF19 ECF19s28

>ECFp9688 ECF19 ECF19s28 Aliterella atlantica CENA595

1 MDSDSLKFRFDNSLQQKDLELLQALKLGETSALSKLYDRYGAVVYGLALK
51 ILKDAQEAEDLTQEVFVTLWHNNTYNPARGSLSNYLVVVTRSRAIDKLRS
101 RTSRRKFLERWRQTTNTQPFSLSASEQIDIWDTSQHVRAALAQLPERQRQ
151 ILEMAYFQDLSQSEIAKTLDIPLGTVKTSARQALKKLRDILSFLTK

Name Aliases LCA Taxa Group Subgroup
ECFp9682
  • RNA polymerase sigma factor
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Crinalium epipsammum PCC 9333 ECF19 ECF19s28

>ECFp9682 ECF19 ECF19s28 Crinalium epipsammum PCC 9333

1 MLSAYYSKLMDIDSTSSPTEKVLPTDAEVFRALKAGQSDAIGILYDRYAS
51 LVYRLSLKILANYQEAEDLTQEIFLTLWRSNTYNPARGSLSSYLTTLTRS
101 RAIDKIRSRGTKLKFLQRWGQMMKTETASNTPFEAASLSQRSHQVHSALA
151 QLPANHRQVLEMAYYDGLSQSEIAKKLDIPLGTIKTWSRQGLLNLRKNLQ
201 DFIE

Name Aliases LCA Taxa Group Subgroup
ECFp9680
  • hypothetical protein
  • CHL7702_RS0113145
cyanobacterium PCC 7702 ECF19 ECF19s28

>ECFp9680 ECF19 ECF19s28 cyanobacterium PCC 7702

1 MDSDSTSEKSNLRLLSDTELFQAVATKDTSALTTLYDRYANLVYSLALKI
51 LKDTSAAEDLTQEVFLRIWHNPNYDPARGSFSSFLVTLTRSRAIDKLRSR
101 NANLKFLDRWWQHVSNQSSAQNPFEKASIEERSQKVRQALAQLPQEQRQV
151 LTMAYYEGLSQTEIAERLQTPLGTVKTRARQGLIKLKKILQDWIN

Name Aliases LCA Taxa Group Subgroup
ECFp9646
Phormidium sp. OSCR ECF19 ECF19s28

>ECFp9646 ECF19 ECF19s28 Phormidium sp. OSCR

1 MSVTDVDLYEQLQSGDRTALGQLYDRYGGLVYGLSLKVLGNPQEAEDLSQ
51 EIFLILWRKQNYDPSRGKLSTFLMMLTRSRAIDRLRSRGRKRKFLGRWGA
101 TLSEDTMTTHTPFDEISLSERRDTVRQALEQLPEKYRSILELAYYQGMSQ
151 SAIADHLNMPLGTVKTRSRKGLLELREHLQEWMG

>ECFp171410 ECF19 ECF19s28 Phormidium ambiguum IAM M-71

1 MKNTDSNPTKNLAQATDAALFQALQAGETSALAVIYDRYSSLVYGLSLRI
51 LTNAQEAEDLTQEIFLLLWRSNTYNPNRGSLSSFLSVLTRSRALDRLRSR
101 SSKLKFLQRSQQTMTIETDNNAPFEQISLSERREFVRQALEKLPLKQRQV
151 LELAYFQGHSHSEIAQQLDTPLGTVKTWARKGLLTLRQNLKELIE

Name Aliases LCA Taxa Group Subgroup
ECFp171409
  • rpoE
  • RNA polymerase sigma factor
  • ... more
Gloeobacter kilaueensis JS1 ECF19 ECF19s28

>ECFp171409 ECF19 ECF19s28 Gloeobacter kilaueensis JS1

1 MDASFALTSGPQVLYPVGHAQQSPVWLSAGEQDRSAMDALNDIEAYRALK
51 QGNASALSLLYDRHGGVVYRLALRLLGSSEEAEDLSQEVFLQLWQKQTYD
101 PARGSLSNFLLTLTRSRAIDRLRSRGARGRFLQRWMREGDVGIAAGSPFE
151 RLAADERSERVQTALKTLPEAQRQALELAYYEGLSQSEIAQRLDTPIGTV
201 KSRSRQGLLKLRNLLFDLLG

Name Aliases LCA Taxa Group Subgroup
ECFp9741
  • DNA-directed RNA polymerase sigma-70 factor
  • N836_01165
  • ... more
Leptolyngbya sp. Heron Island J ECF19 ECF19s28

>ECFp9741 ECF19 ECF19s28 Leptolyngbya sp. Heron Island J

1 MPSEHRESPAPDWGDETDEALFTSLQQGNKAALAVLYDRYSRLVYTVAFR
51 ILNNGPEAEDLTQEIFLNLWQKQTYNPKRSALSRFLSTVTRNRAIDRVRS
101 RSIRRRILKGLVPQSQPVTSFSLPVEQASLGERSQRVREALKNLPEKQRE
151 LLWLAYYHGFSQSEIANHTNIPLGTVKSRMRQGLLKLKGTLQDLVD

Name Aliases LCA Taxa Group Subgroup
ECFp9722
  • RNA polymerase sigma factor
  • OSCIL6407_RS0113275
Kamptonema ECF19 ECF19s28

>ECFp9722 ECF19 ECF19s28 Kamptonema

1 MDLNPAETSVDDPDKQTDAELFQLISVGQASALGILYNRYGSLVYRLALR
51 ILTNPQEAEDLTQEIFINLWQKRTYNPNRGSLSSFLTTLTRSRAIDKLRS
101 RSTKLKFLQRWSQMMATEIPPLTPFESASLSDRSHYVRDALAQLPEKQRQ
151 VLEMAYYDGLSQSEIAAKLSIPLGTIKTWSRQGLLNLRKNLQNLIG

Name Aliases LCA Taxa Group Subgroup
ECFp9715
  • RNA polymerase subunit sigma
  • AY599_26445
  • ... more
Cyanobacteria ECF19 ECF19s28

>ECFp9715 ECF19 ECF19s28 Cyanobacteria

1 MLGFSFGANLFVRPIPNRRYPSKSTAGFDAYSRQRPDRESQYRRMRGAII
51 SVSPKATLPMSPSDIELYQSLQAGDSSALGTLYDRYGGIVYGLALKVLKA
101 PQEAEDLTQEIFLILWRKQNYNPQRGSLSTFLTMLTRSRAIDRLRSRGRK
151 QKFLGNWGTAMSEDAIVSTTPFDEVSLQERRDRVRDALDDLPSKYRQVLE
201 LAYYQGMSQSEISAYLDLPLGTVKTRSRQGLLKLREHLRDWIG

Name Aliases LCA Taxa Group Subgroup
ECFp9708
  • RNA polymerase subunit sigma
  • CYB_RS02755
Synechococcus sp. JA-2-3B'a(2-13) ECF19 ECF19s28

>ECFp9708 ECF19 ECF19s28 Synechococcus sp. JA-2-3B'a(2-13)

1 MGEQPGTPSRWRERVRDWSSRADWELMEALKAGQPAALAALYDRYAGLVY
51 GLAFKILGHVAEAEDLTQEVFVELWRKVGCDPRTPSESRERRGSLSSFLC
101 ILTRSRAIDRLRSQGSHQLLLKRWQTILSADRVSGTESFSKTRFPFEQVS
151 IEERRQAVQAALSQLPENQRQILELLYYQGLSQADIARQLGIPLGTVKTR
201 SRQALCKLRGSLRALLGFCSR

Name Aliases LCA Taxa Group Subgroup
ECFp9702
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Leptolyngbya sp. PCC 7375 ECF19 ECF19s28

>ECFp9702 ECF19 ECF19s28 Leptolyngbya sp. PCC 7375

1 MLSERPESQSPDWGDATDEALFVALQQGDKSALAVLYDRYSRLVYTVAFR
51 ILNNGPEAEDLTQEIFLNLWQKQTYNPTRSALSRFLSTVTRNRAIDRVRS
101 RSIRRRILKGMVPQQSQPVAAFSLPVEQASLGERSQRVRAALKNLPEKQR
151 ELLWLAYYHGFSQSEIANHTNIPLGTVKSRMRQGLLKLKGTLQDLVD

Name Aliases LCA Taxa Group Subgroup
ECFp9697
  • RNA polymerase sigma factor
  • OSCCY1_RS14725
[Leptolyngbya] sp. JSC-1 ECF19 ECF19s28

>ECFp9697 ECF19 ECF19s28 [Leptolyngbya] sp. JSC-1

1 MNPDSSALRPTAASISSESSDLELLTALAAGQVHALGILYDRYAKLVYSL
51 AFKILENSEEAEDITQDVFLTLWRRNTYNPSRGSLSSFLTTMTRSRAIDK
101 LRSKGARLRVIQRLQGIVRTEPSSTTPLEQASVGERAQLIRDALAQLSET
151 ERQVLEIAYYEGLSQSEIAKRLNIPLGTVKTRSRQGLLKLRQTLQDYI

Name Aliases LCA Taxa Group Subgroup
ECFp1481
  • RNA polymerase sigma factor
  • RNA polymerase sigma factor, ECF family
  • ... more
Synechococcus sp. JA-3-3Ab ECF19 ECF19s28

>ECFp1481 ECF19 ECF19s28 Synechococcus sp. JA-3-3Ab

1 MGEQPPLRDWPSRSDGELMEAIRERQGAALGVLYDRYAGLVYGLALQILG
51 HVAEAEDLTQAVFVELWRKASYDPQRGSVSSFLCLLTRSRAIDRLRSQDS
101 SQRLLKHWQSLLAAENRAPAPFEQLSLEERRQAVQEALGQLPESQRQVLE
151 LIYYQGLSQADVARHLGIPPATVKARARQALCKLRGSLRALLEVWS

Name Aliases LCA Taxa Group Subgroup
ECFp1479
  • RNA polymerase sigma factor
  • glr1158
Gloeobacter violaceus PCC 7421 ECF19 ECF19s28

>ECFp1479 ECF19 ECF19s28 Gloeobacter violaceus PCC 7421

1 MDTLASANDFFGLWPQAIYSVEEIRHTPNPPSSAAEHQRNAMDPPSDAEV
51 YVDLKRGNPAVLGVLYDRHGKMVFRLAMRILANSQEAEDLTQEVFLTLWQ
101 KKAYDPARGSLSNYLLTLTRSRAIDRVRSRGSNLRFLQKWTQELGTGTAP
151 GPSPFERVANAEVAHQVKTALEQLPEAQRQALELAYYEGLSQSEIASRLD
201 TPLGTVKTRSRQGLLKLRNLLRGLVG

Name Aliases LCA Taxa Group Subgroup
ECFp1476
  • RNA polymerase sigma factor, ECF family
  • CYB_0582
Synechococcus sp. JA-2-3B'a(2-13) ECF19 ECF19s28

>ECFp1476 ECF19 ECF19s28 Synechococcus sp. JA-2-3B'a(2-13)

1 MRDWSSRADWELMEALKAGQPAALAALYDRYAGLVYGLAFKILGHVAEAE
51 DLTQEVFVELWRKVGCDPRTPSESRERRGSLSSFLCILTRSRAIDRLRSQ
101 GSHQLLLKRWQTILSADRVSGTESFSKTRFPFEQVSIEERRQAVQAALSQ
151 LPENQRQILELLYYQGLSQADIARQLGIPLGTVKTRSRQALCKLRGSLRA
201 LLGFCSR

Name Aliases LCA Taxa Group Subgroup
ECFp9754
  • RNA polymerase sigma factor, sigma-70 family
  • RNA polymerase subunit sigma
  • ... more
Microcoleus sp. PCC 7113 ECF19 ECF19s28

>ECFp9754 ECF19 ECF19s28 Microcoleus sp. PCC 7113

1 MSGIYSKMMGSGLFYEKPTDLKGIGTPEDCHDLQSDEELIQALKAGQSSA
51 LGILYDRYASLVYRLALRILTNPQEAEDLTQEIFLNLWRSGSYNPSRGSL
101 SSFLTTLTRSRAIDKIRSRGSNLKFIQRWSQMMVNETSSLTPFESAALSQ
151 RSHQVRQALTQLPEKQRQVLEMAYYEGLSQSEIAAQLGIPLGTIKTWSRQ
201 GLLNLRKNLRDFIE

Name Aliases LCA Taxa Group Subgroup
ECFp9751
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Cylindrospermum stagnale PCC 7417 ECF19 ECF19s28

>ECFp9751 ECF19 ECF19s28 Cylindrospermum stagnale PCC 7417

1 MHPDSPNNKPDLKESTDAALFQALTARDASALAMLYDRYANLVYGLALKI
51 LRDPQAAEDLTQEVFLALWRHPNYNPARGSLSSFLVTLTRSRAIDKLRSR
101 GASLKFLDRWSQQMSNQPLTNNPFEQVSIEERSQKVRSALAQLPENQRQV
151 LAMAYYEGLSQVEIAQRLEAPLGTVKTRARLGLIKLKRILQDWIN

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more