ECF proteins of ECF subgroup ECF19s21

Displaying ECF 1 - 20 of 28 in total
Name Aliases LCA Taxa Group Subgroup
ECFp98543
  • hypothetical protein
  • ASG76_08980
  • ... more
Nocardioides sp. Soil774 ECF19 ECF19s21

>ECFp98543 ECF19 ECF19s21 Nocardioides sp. Soil774

1 MEALAVRFRAGHEEALGEVYDRWSALVHTYALRALADTHDAEDVTQQVFV
51 AAWRSRETMTPSPSTFPAWLLGIARHKIADARAARARDVRRIEAVVAATP
101 SDEGVGAEDVMEPDRIVVRQAVDEMAEPRRTIMLLAFWQDLTHADIAAST
151 GLPLGTVKSHLRRGLTQLHRTLEEVRHGSR

>ECFp96151 ECF19 ECF19s21 Tessaracoccus lapidicaptus

1 MADATTTPIGVLARRFAAGDESALRETYERWSRLVHTIARTSLGSSADAD
51 DVTQQVFIAAWQSRATLRATDESLPAWLLGICRLKVIDALRARSRAFRKD
101 ELLASEAMAGEPPVEAARVDEVIDSVIVQDALAALGDPRATILRLVYLED
151 HTHDEVARRLDLPLGTVKSHVRRGLERLRAVFEEVDAA

Name Aliases LCA Taxa Group Subgroup
ECFp94115
  • RNA polymerase subunit sigma-24
  • INTCA_RS02855
Intrasporangium calvum DSM 43043 ECF19 ECF19s21

>ECFp94115 ECF19 ECF19s21 Intrasporangium calvum DSM 43043

1 MHVHDEPGVDSGELATALAAGSTDALEEIYRQWSGLVHTIALRSLGDPAD
51 AEDVTQQVFVSAWNGRHSFRPDQGSIQAWLVGITRHRVADLRTQRYRNHR
101 NVQAVALESAATPPVTDDTEWAQRLLLVHELERMGDPRAAVIRMAFLEDR
151 SHDDIADTLGLPLGTVKSHVRRGLLQLRERLQEVNRVSS

Name Aliases LCA Taxa Group Subgroup
ECFp92202
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • Intca_0565
Intrasporangium calvum DSM 43043 ECF19 ECF19s21

>ECFp92202 ECF19 ECF19s21 Intrasporangium calvum DSM 43043

1 MSTAVPTRAAGYGVLVHVHDEPGVDSGELATALAAGSTDALEEIYRQWSG
51 LVHTIALRSLGDPADAEDVTQQVFVSAWNGRHSFRPDQGSIQAWLVGITR
101 HRVADLRTQRYRNHRNVQAVALESAATPPVTDDTEWAQRLLLVHELERMG
151 DPRAAVIRMAFLEDRSHDDIADTLGLPLGTVKSHVRRGLLQLRERLQEVN
201 RVSS

Name Aliases LCA Taxa Group Subgroup
ECFp89956
  • RNA polymerase subunit sigma-24
  • IF16_RS0107595
Corynebacterium variabile ECF19 ECF19s21

>ECFp89956 ECF19 ECF19s21 Corynebacterium variabile

1 MHVHDDPDVESAELAARLSGGDREALAEMYRRWSPLVHTIALRSLGTRED
51 AEDVVQQVFVAAWRGRETLRPDRGSPAAWLVGIAKHRIADVRTQRYRTHR
101 NLQALATEAVTEAPAPDDSDWAERLLLVHELERMGDPRATVLRMAFIEDR
151 TQDEIARALDMPLGTVKSHVRRGLIELRDRLKEVERVSSE

Name Aliases LCA Taxa Group Subgroup
ECFp89057
Terrabacter sp. 28 ECF19 ECF19s21

>ECFp89057 ECF19 ECF19s21 Terrabacter sp. 28

1 MHVHDDPDVESAELAARLSGGDREALAEMYRRWSPLVHTIALRALGTRED
51 AEDVVQQVFVAAWRGRATLRPDRGSPAAWLVGITKHRVADVRAERYRAHR
101 NLQAVASEVATAPDAAGDSDWAERLLLVHELERMGDPRATVLRMAFIEDR
151 THEDIARALDLPLGTVKSHVRRGLMALRDRLKEVERVSPE

Name Aliases LCA Taxa Group Subgroup
ECFp87206
  • hypothetical protein
  • ASG49_16105
  • ... more
Marmoricola sp. Leaf446 ECF19 ECF19s21

>ECFp87206 ECF19 ECF19s21 Marmoricola sp. Leaf446

1 MTGSGLRGSAVVDLATALRDGRHDALEELFDRWSPLVHSLAWQALRDPHE
51 ADEVTQLVFVSAWRSRETLRPSDTALPAWLVGICRHRIADRFADRSRESR
101 RLARMASEEDVLEADRVEVLGTEQFLEALTMEEALGALPEPRQTVVRLAF
151 LEDQTHAEISRRLGLPLGTVKSHVRRGLLQLRDRLAVSHDDAPR

>ECFp85432 ECF19 ECF19s21 Terrabacter

1 MHVHEDPDVESAELAVRLIGGDREALAEMYRRWSPLVHTIALRALGTRED
51 AEDVVQQVFVAAWRGRATLRPDRGSPAAWLVGITKHRVADVRTQRYRTHR
101 NLQALASEVVTEPTTTHDSDWAERLLLVHELERMGDPRATVLRMAFIEDR
151 THDDIARTLEMPLGTVKSHVRRGLLELRDRLKEVERVASD

>ECFp85079 ECF19 ECF19s21 Branchiibius sp. NY16-3462-2

1 MAALWLADGVPPEGDSRADAELSARLASGDPDALAEMFQRWGTLVHTIAR
51 RALDDAHDAEDVTQQVFLAAWRSRHTLVPGHGSPAAWLVAITKHRIADVR
101 QQRQRARRNLDAAILDASAPPVGDADLADQIFVVHELEQLGDPRAAILRL
151 AIIEDRPYAEISEHLGIPLGTVKSHVRRGLVELRRRLKESGDGAP

Name Aliases LCA Taxa Group Subgroup
ECFp83403
  • RNA polymerase subunit sigma-24
  • ASD62_07410
  • ... more
Phycicoccus ECF19 ECF19s21

>ECFp83403 ECF19 ECF19s21 Phycicoccus

1 MTTVEGVLALDELVAEQDDLAARFASGSREALAEVYERWSALVYTVALRA
51 LDDAHDAEDVTQQVFVSAWGSRHTLRPSEGAIPAWLVGITRHKVADVRTQ
101 RYRRARNLAAVASVTPEAGSPPPEPDIAQRLLVAHEVDRLGEPRASVLRL
151 AFIEDRPQEEIAERLGLPLGTVKSHVRRGLVQLRSRLEEVDDDSPR

>ECFp82806 ECF19 ECF19s21 Terracoccus sp. 273MFTsu3.1

1 MSPTWLGGSVHVHDDPDVESAELAVRLSGGDREALAEMYRRWSPLVHTIA
51 LRALGAREDAEDVVQQVFVAAWRGRATLRPDQGSPAAWLVGITKHRIADV
101 RTQRYRTHRNLQAVASEVVTEQAPTHEADWAERLLLVHELERMGDPRATV
151 LRMAFLEDRTQEEIARTLEMPLGTVKSHVRRGLLELRDRLKEVERVASD

>ECFp81165 ECF19 ECF19s21 Humibacillus sp. DSM 29435

1 MHVHDDPNTDLDGARLAGELVAGSSDALAEMYRRWSTLVHTIAYRSLGDR
51 HDAEDVTQQVFVSAWNGRHTLRPDAGSPAAWLVGITKHRVADVKMQRYRS
101 HRNLHAVAAQSATEPSEQHDDWAEKLLLVSELERMGDPRAAVLRMAFMED
151 KPQDEIARTLDLPIGTVKSHVRRGLIELRRRLEEVEHVAP

>ECFp79532 ECF19 ECF19s21 Terrabacter sp. Soil811

1 MHVHDDPDVESAELAVRLVGGDREALAEMYRRWSPLVHTIALRALGTRED
51 AEDVVQQVFVAAWRGRATLRPDRGSPAAWLVGITKHRVADVRTQRYRAHR
101 NLQALASEVVTEPTTTHDSDSAERLLLVHELERMGDPRATVLRMAFIEDR
151 THDDIARMLQMPLGTVKSHVRRGLLELRDRLKEVERVASD

Name Aliases LCA Taxa Group Subgroup
ECFp78879
  • RNA polymerase subunit sigma-24
  • N865_09255
  • ... more
Intrasporangium oryzae NRRL B-24470 ECF19 ECF19s21

>ECFp78879 ECF19 ECF19s21 Intrasporangium oryzae NRRL B-24470

1 MHVHEDPDVEANELAAALAGGSEDALAEIYRRWSGLVHTIALRSLGDASD
51 AEDVTQQVFVSAWQARHTLRPDLGSIPAWLVGITKHRVADVRTQRYRNQR
101 NLRAVALETAAAPTSSGDGDWAERLLVVHELERMGDPRAAVLRMAFIEDR
151 PQEEIAAALDLPLGTVKSHVRRGLIELRQRLKEVERVSP

>ECFp168044 ECF19 ECF19s21 Tessaracoccus oleiagri

1 MIVEDLTPVGVLAGRLAAGDPLALREAFDRWSRLVHTVARSALGSVADAD
51 DVTQQVFIAAWNSRASLRATDESLPAWLLGICRLKVIDALRARSRGLRND
101 EAMHSEGMRSDQGQPAGLDSVVDAVVVRDALDALGDPRGRVLRMVYLEDR
151 THEDVAAALQLPLGTVKSHVRRGLEKLRGIFEEVDSGV

Name Aliases LCA Taxa Group Subgroup
ECFp166752
Tessaracoccus flavus ECF19 ECF19s21

>ECFp166752 ECF19 ECF19s21 Tessaracoccus flavus

1 MSPATRTPCATLVHMAPDDRQTPVGLLATQLAAGDESALREAYHRWSRLI
51 HTIARNSLGSAADADDVTQQVFIAAWNSRASLRASDEALPAWLIGICRMK
101 VIDALRARSRGFRNEEAMMSEALDEPVVRNLDGVIDSVVVRDALAALGDP
151 RAQILTMVYLEDKTHDDVARHLSIPLGTVKSHVRRGLERLRSVFEEVDSL
201 V

>ECFp165042 ECF19 ECF19s21 Friedmanniella luteola

1 MAPSDVRGGPAVADHAGVALSRSALDDTGEGLLVTVDPPPRTAVDAVDWA
51 GMSDADLGLAFADGLDGSLEESFRRWGTLVNTVAWRLLGDAGEAEEVTQQ
101 VYVAAWRGRHTFAPDRGSLAAWLLGSTRHRVVDRQRARGREIRLIRAAAE
151 DAVQQSSPEAPEVVTDRLLLADEIARLPDPRRSILQLAFYDGYTHAEISE
201 RLGLPLGTVKSHARRALLHLRDRLTTS

>ECFp163160 ECF19 ECF19s21 Nocardioides exalbidus

1 MVSGVSEFEGRDDVRSLASRLVAGEEAALEAIFDRWSALVHTFALRALAD
51 HHDAEEVTQQVFVSAWQARHTLVPTPGALPAWLLGIARHKVADVRAARAR
101 DARKVARVAAVPDATTVHDEELVDRVVVRQVVDEMPDPRRAILRLAFWGD
151 LTHNQIADRTELPLGTVKSHLRRGLLELHHRLEEVRHDPSST

>ECFp161387 ECF19 ECF19s21 Friedmanniella sagamiharensis

1 MSAEVAGAQPSPLVPVVQELGRRAVERVVGTEDADRTGPEDRTVGVHGAD
51 GEGRADEVVGELGADPGVDLGVDLGVDLGVEEARIARGFAAGDRACLEEA
101 YRRWAPLVHTLARRELRRTVDAEDVTQQVFVSAWRSRADYSPGRGSLPGW
151 LVGITRHRLLDHHRRQQRQQRLASTLEDEAVVAWGPSVPTTDEELDRLLI
201 AAEIAQLPDPRGTILRMAFWEGYTYPQIADGLDLPLGTVKSHVRRTLLHL
251 RDRLREARTWST

Name Aliases LCA Taxa Group Subgroup
ECFp152279
Nocardioides alpinus ECF19 ECF19s21

>ECFp152279 ECF19 ECF19s21 Nocardioides alpinus

1 MSTVAFPTLPSRRYGGAVVTGMSEVEEEQDDGVRSLAARLVAGDETALEQ
51 VYDRWSALVHTYALRALRDAGDAEEATQQVFVAAWRSRHTLVPSPHALPA
101 WLIGIARHKVSDVRLARSRDADRAAAVAAQPEAHAVVEAADEEVADRLVV
151 RQAVEELPDPRRTIVFLAFWEGLSHAEIADTVGLPLGTVKSHVRRGLVTL
201 HQQLEGVRRESR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more