ECF proteins of ECF subgroup ECF19s19

Displaying ECF 1 - 20 of 29 in total

>ECFp116385 ECF19 ECF19s19 Pseudanabaena sp. 'Roaring Creek'

1 MDSCDRKFLKVDTASRQDEILLISRIAEQDQTALSLLYDRYSRIIYTIAY
51 RILNSAEESEEIVLDVFTQVWRIAKNYNSQKARVDTWLFMLTRSRALDRL
101 RSYARLDKAVAISEDAIMMKPHTDSPEEDVLIRERRSYVTTCLSEIPDDQ
151 RLVLELAYFGGLSHSEISAKTGISLGTVKTRIRLGLKKLRELIGDEWSSF

Name Aliases LCA Taxa Group Subgroup
ECFp1491
  • gll2708
  • RNA polymerase ECF-type (group 3) sigma factor
Gloeobacter violaceus PCC 7421 ECF19 ECF19s19

>ECFp1491 ECF19 ECF19s19 Gloeobacter violaceus PCC 7421

1 MTDPNRTDEAALVARIARQDQSALSELYDRYVRMLAAVAFKILGSLEEAE
51 EVVLDVFCQVWRTAASYDARRSRVDAWLFMLTRSRSLDRLRALQRSARAR
101 NASVQEAHVQWPIREADTAEQLDLIEWRGRVSAALERLPDEQRRVLELAY
151 YQGLTHTQIAAQTGKPLGTVKTRIRLGLNKLRDALGNGG

>ECFp149430 ECF19 ECF19s19 Gloeomargarita lithophora Alchichica-D10

1 MDDETLLERIAIQDQSALNALYDRYSQVIYSLIYRIVGVKEEAEEIILDV
51 FLQVWRTAHCYNPHQAQVNSWLFMIARSRALDRLRRQSRQQRTTLMLQQT
101 QMPLDLSSPPEAYILGEETHQNLQNALAQLPPEQRQAVELAYYYGLSHTQ
151 IAVRLGVPPGTIKSRIRMALQKMRQAFHIAPEQ

>ECFp38980 ECF19 ECF19s19 Chamaesiphon minutus PCC 6605

1 MLQSPIEPAKLLINIAKGDRSALSQLYDRYSRMIYAIAWKSLNSVEECEE
51 VVLDVFAQIWRIADRFDLNKGSAEQWIFTLARSRTLDRLRKFQRLQKVNE
101 AIDAGKEIDFPTASVDPIEAIEISERRQQVLAALEQIPPAQRQVIEMAYY
151 QGLTHSEIATATGLSLGTVKTRLRLGLSKLKLGFENKS

Name Aliases LCA Taxa Group Subgroup
ECFp9725
  • rpoE
  • RNA polymerase
  • ... more
Acaryochloris marina MBIC11017 ECF19 ECF19s19

>ECFp9725 ECF19 ECF19s19 Acaryochloris marina MBIC11017

1 MTVQNTSEDLVLIHQVAEQNQAALSMLYDRYAGIIYAIAYKMLGSVEEAE
51 EVVLDVFDQVWRTAAKYDRSRSRVDSWLFMQARSRTLDRLRKRQRQAKVV
101 EASTVNAPIESDTKMALPEEHALIQERRDLVQVAMAQIPPEQQQVIELAY
151 FQGLSQSEIAKQTGLSLGTVKTRIRLGLSKLRGILDQS

Name Aliases LCA Taxa Group Subgroup
ECFp9740
  • hypothetical protein
  • PSE6802_RS0104790
Pseudanabaena sp. PCC 6802 ECF19 ECF19s19

>ECFp9740 ECF19 ECF19s19 Pseudanabaena sp. PCC 6802

1 MAQQQYSVDEAHLLERITAKDQAALSILYDRYARIIYTLAYRVLGSVEES
51 EEVVLDVFNQVWRIAGTYTAQKGRVDAWLFMLTRSRALDRLRSLARTTKA
101 TVASEELAMTRSPSDTPEENAILLERSAVVKSALAQLPVEQREVLELAYY
151 KGMTHTQIALATGKSLGTIKTRIRLGLNKLRESLKAIGEDD

Name Aliases LCA Taxa Group Subgroup
ECFp35078
  • hypothetical protein
  • CAL7103_RS0126725
Calothrix sp. PCC 7103 ECF19 ECF19s19

>ECFp35078 ECF19 ECF19s19 Calothrix sp. PCC 7103

1 MDCRPVSDDALLSQIAKHDQTALSELYNRYAKIIYSVAFSSLKSVEESEE
51 VVLDVFSQVWRIAERYDTTKGRVDTWVFMLARSRILDKLRKLQRSQFSSP
101 VLTKLSEIETSTTIDPTENVAIYERRQRVSDALQLLPKEQRQVIELAYYH
151 GLSHSQISVQTGISLGTVKTRIRLGLNKLKSALE

Name Aliases LCA Taxa Group Subgroup
ECFp9756
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Oscillatoria nigro-viridis PCC 7112 ECF19 ECF19s19

>ECFp9756 ECF19 ECF19s19 Oscillatoria nigro-viridis PCC 7112

1 MTWNFYHSKHDKISLKRPTPVCTPTSNLQLCSVVIYAEFLILDLCRQNKN
51 FGYTEMTGQKSGDESLLLVQIARKDQTALAKLYDRYGRPSYALAYKILGS
101 VEEAEEVVIDVFSQIWQKAATYDPSRSRADTWLFMLTRSRSLDRLRAMQR
151 TVRAAEACLEDAKVPISSVAEPMEDAMFKERSEQVKAALEKLPKEQQEAI
201 ELAYYQGLTCAAISAKTGIPVGTIKTRIRLGISKLRQALSEQFF

>ECFp9745 ECF19 ECF19s19 Microcoleus vaginatus FGP-2

1 MTGQKSGDESLLLVQIARKDQTALAKLYDRYGRPSYALAYKILGSVEEAE
51 EVVLDVFSQIWQKAATYDPSRSRADTWLFMLTRSRSLDRLRSVQRTVRAA
101 EACLEEAKVPIFSVAEPMEDAMFKERREQVKAALEKLPKEQQQAIELAYY
151 QGLTCAAIAAKTGIPTGTIKTRIRLGISKLRQALSEQF

Name Aliases LCA Taxa Group Subgroup
ECFp9669
Leptolyngbya sp. O-77 ECF19 ECF19s19

>ECFp9669 ECF19 ECF19s19 Leptolyngbya sp. O-77

1 MTSQPSTSEESHLLARIAQQDQSALSTLYDRYARVLYSLAFRILGSVEEA
51 EEIVLDVFSQVWKLAKRYDPQRGRVDAWLFMLTRSRSLDRLRSLQRVSKA
101 VESSTEAAKTVSQTQISDPTEDVLINERRDRVLAAMQRLPTEQREVIELA
151 YYQGLTHVEIAAKTGKSLGTVKTRIRLGLNKLRQALEALDWLE

Name Aliases LCA Taxa Group Subgroup
ECFp9672
  • RNA polymerase
  • SYN7336_RS23655
Synechococcus sp. PCC 7336 ECF19 ECF19s19

>ECFp9672 ECF19 ECF19s19 Synechococcus sp. PCC 7336

1 MVERKPVDDIDLVGQIARGERAALSALYGHYAGVVYALAFKILGSVEEAE
51 EVVLDAFAQVWRSAEQYESQRGRVDTWLFTIARSRALDRLRSRQRSARIL
101 ASVQAEVKVSAPTQIHNPADSVVLNERRERVQIAMQQLPDPQRLVLEMAY
151 FQGLTQAEIATEIGKPVGTVKTRVRLGLSKLRDALGGLNESP

Name Aliases LCA Taxa Group Subgroup
ECFp9667
  • rna sigma-24 ecf subfamily
  • N836_16790
  • ... more
Leptolyngbya sp. Heron Island J ECF19 ECF19s19

>ECFp9667 ECF19 ECF19s19 Leptolyngbya sp. Heron Island J

1 MAKLQSKDETELIRRMVQGDQAALSQLYDRYARVMYGLAFKILGSVEEAE
51 EVVLDVFAKAWRTAARYDASRSRVDSWLFLMTRSRSLDRLRQRQRQTKVV
101 EAAKNTAQVSSFDVPDDVLLITERRTVVTQALAELPNEQRLVIELAYYKG
151 FSQSEIAKQTGLALGTVKTRIRLGLRKLKQALATD

>ECFp9648 ECF19 ECF19s19 Acaryochloris sp. CCMEE 5410

1 MTVQNTSEDLVLIHQVAEQNQAALSTLYDRYAGIIYAIAYKMLGSAEEAE
51 EVVLDVFDQVWRTAAKYDRSRSRVDSWLFMQARSRTLDRLRKRQRQAKVV
101 EASTVNAPIESDTKMALPEEHALIQERRDLVQVAMAQIPPEQQQVIELAY
151 FQGLSQSEIAKQTGLSLGTVKTRIRLGLSKLRGILDHP

Name Aliases LCA Taxa Group Subgroup
ECFp95630
  • hypothetical protein
  • IJ00_01330
  • ... more
Calothrix sp. 336/3 ECF19 ECF19s19

>ECFp95630 ECF19 ECF19s19 Calothrix sp. 336/3

1 MTTQTETDQAALIARIAQQDESALSELYDRYGKILYAVAFKMLGTVEEAE
51 ETVLDVFHQVWRTAQRYDATKARVDTWLFMQLRSRAIDKLRIRERMTRTP
101 IVSLDAVEQEARSLSVDPSEEIIFSERRTLIQTAIRELPPEQQQVLELAY
151 FQGWSHTEISTQTGIPLGTIKTRIRLGLTKLRGVLASLRES

Name Aliases LCA Taxa Group Subgroup
ECFp93763
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • Pse7429DRAFT_4697
  • ... more
Pseudanabaena biceps PCC 7429 ECF19 ECF19s19

>ECFp93763 ECF19 ECF19s19 Pseudanabaena biceps PCC 7429

1 MDSCDRKFLKVDTASRQDEISLISRIAEQDQTALSLLYDRYSRIIYTIAY
51 RILNSAEESEEIVLDVFTQVWRIAKNYNSQKARVDTWLFMLTRSRALDRL
101 RSYARLDKAVAISEDAIMMQPHTDSPEEDVLIRERRSYVVACLSEIPDEQ
151 RLVLELAYFGGLSHSEISTKTGISLGTVKTRIRLGLKKLRELIGEEWSSF

>ECFp41076 ECF19 ECF19s19 Leptolyngbya sp. NIES-2104

1 MTIEPASDDFSLIKRIAQQDQAAMATLYDRYAPTLYAVAFQTLGSVQESE
51 EVVLDVFAQVWRTAIRFEAAKTQVDTWLFIITRSHTLARLRTMQQTEKTS
101 IVVEASMSSVTSDPLQDVLISERRDQIQAALAQLSAEQRQVIELAHYQGL
151 SHSEIATQLELPLGTVKTRIRLGLHRLRIALNTWKPS

Name Aliases LCA Taxa Group Subgroup
ECFp40817
  • RNA polymerase
  • OSCCYDRAFT_RS07800
Oscillatoriales cyanobacterium JSC-12 ECF19 ECF19s19

>ECFp40817 ECF19 ECF19s19 Oscillatoriales cyanobacterium JSC-12

1 MPSEIDDVSLLARIAQRDQSALAIFYDRYARIVYAIALKSLRSIEESEEV
51 VLDVFSQVWRIAERYDVQRSKPNTWLFTLARSRILDRLRKLRRVNSSSTI
101 SLDALEIQPKADSVDLFEQVAMTERRGRVLAAMQTLPDEQRMAITLVYYQ
151 GLTHSEIATQTGLSLGTVKTRIRLGLSKLKSALNTEEDLNRPG

Name Aliases LCA Taxa Group Subgroup
ECFp37278
  • hypothetical protein
  • OSCCY1_RS17460
[Leptolyngbya] sp. JSC-1 ECF19 ECF19s19

>ECFp37278 ECF19 ECF19s19 [Leptolyngbya] sp. JSC-1

1 MAAPSRPESAIIERIAQQDQIALSELYDRYARVIYAVAYKSLNSVEESEE
51 VVLDVFAQVWRIASQYKPEKGRVDTWLFMLARSRILDRLRSLQRVSKKTM
101 ASVEAAQIQFNQQTVDPVEDALIGERRTQVLAALEQLPVEQRQAIELAYY
151 SGLSHSEIAAVTGLSLGTVKTRIRLGLTKLRDRLGAWD

Name Aliases LCA Taxa Group Subgroup
ECFp36956
  • RNA polymerase
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Cyanothece sp. PCC 7425 ECF19 ECF19s19

>ECFp36956 ECF19 ECF19s19 Cyanothece sp. PCC 7425

1 METSPAVDDVVLLQRIAQRDQVALSMFYDRYARIIYGLAYKSLRSVEESE
51 EAVLDVFAQIWRIADRYDPQKGRVDTWLFTLARSRILDRLRKLQRSQAPL
101 TLSIDAMDRPPPAAGVDLFEDVVVAERRSKVSAALQTLPEEQRLVLELAY
151 YQGLSHSQIASQTGLSLGTVKTRIRLGLSKLKSAFSSKEDL

Name Aliases LCA Taxa Group Subgroup
ECFp35707
  • RNA polymerase, sigma subunit, ECF family
  • OsccyDRAFT_1628
Oscillatoriales cyanobacterium JSC-12 ECF19 ECF19s19

>ECFp35707 ECF19 ECF19s19 Oscillatoriales cyanobacterium JSC-12

1 MALSHSAFFEMGIVNISDSRAEQQSNIPCNSEPHSKFENLVNQVAFFPRN
51 SPSQKPPNWKEIPSEIDDVSLLARIAQRDQSALAIFYDRYARIVYAIALK
101 SLRSIEESEEVVLDVFSQVWRIAERYDVQRSKPNTWLFTLARSRILDRLR
151 KLRRVNSSSTISLDALEIQPKADSVDLFEQVAMTERRGRVLAAMQTLPDE
201 QRMAITLVYYQGLTHSEIATQTGLSLGTVKTRIRLGLSKLKSALNTEEDL
251 NRPG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more