ECF proteins of ECF subgroup ECF19s11

Displaying ECF 1 - 20 of 42 in total

>ECFp76041 ECF19 ECF19s11 Nocardia yamanashiensis NBRC 100130

1 MADERRFRTVVRDTGETSADACPVRPVTSETEIALRLTALLGGIADGDRE
51 AFTEFYRSTHDRVYGLALRVLRRPAAAEEVTQELYLYVWKSAGQFDPRLA
101 SPIGWLMMLTHRRAVDRVRVEASATTRDIAYGHRHLGRDHDVVAETVGQR
151 AEEQAVVHCLETLTATQRETVALAYYGGRTYAEVAAHLGIPLNTVKTRIR
201 DGLKRLQNCLTGSMSDA

>ECFp76027 ECF19 ECF19s11 Nocardia yamanashiensis NBRC 100130

1 MVVDALPRVVAESSCPTGNPDGPELTARLTALVAAVGAGDRDAFTELYRL
51 TSNRVYGLALRMLRNRGTAEEITQEVYLQAWTLAARYDAHLSGPVGWLLM
101 LTHRRAVDRIRSERAAANREFTYGRTYSVRDHDTVLESVQQRLDEDAVRH
151 CLDRLTRLQRDAVVLAYYGGHTYAEIADQLGTPVSTVKTRIRDGLRRLAV
201 CLNGSELR

>ECFp75892 ECF19 ECF19s11 Nocardia inohanensis NBRC 100128

1 MADEQRGYPVGIEAPDEDPAPVCPASRPGADPETVRRLIDLLAAIADGDR
51 EAFTEFYRSTHHRVFGLALRILRRVAAAEDVAQEVYLQVWNTAGRYDPRL
101 AGPMGWLMMLTHRRSVDRVRVEAATTARDIAYGHRHLGRDHDIVAETVAQ
151 HSDERAVVQCLEVLTRTQRETLALAYYGGRTYNEVAAQLEIPLNTVKSRI
201 RDGLKRLQNCLTGAVTDV

>ECFp75868 ECF19 ECF19s11 Mycolicibacterium mucogenicum

1 MSTPSGSDRLRQIDPVLAQPCDDSRMEGEPDRVALLTAIADGDSAAFTEF
51 YDLTSPRVFGLAYRVVRDRTLAEDVVQEVFLQVWSSAARQYDPALASPIG
101 WLMTLTHRRSIDRVRSEQSAADRNHAYGASNLGREHDTVADEVGQRLDEQ
151 EVTDCLDGLTAVQREAIGLAYYSGHTYREVAEHLAVTLPTIKARIRDGLI
201 RLKNCLGVGTDA

>ECFp75818 ECF19 ECF19s11 Nocardia coubleae NBRC 108252

1 MTNGPGSSPIRLRSVPTDPPTCPPDRGADRAVQARLVTLLDDVAAGSRPA
51 FTEFYRTTSPRVFGLALRVVRSHALAEEIAQEVFLQVWSLASDYDQDRAS
101 PIGWLMMLTHRRAVDRVRAEQSATSRDIVFGHCHLGRDHDVVTEEVTQRL
151 DEQSVLDCLETMTALQREAVALAYYSGRTYAEVSETLAVPLPTVKSRIRD
201 GLKRLENCLTGGTSR

>ECFp75792 ECF19 ECF19s11 Mycolicibacterium mucogenicum

1 MSTPPGSDGLRQIAPVPTPPCDDSRMEGEPDRAALLTAIADGDRTAFTEF
51 YDLTSPRVFGLAYRVVRDRTLAEDVVQEVFLQVWSSAARQYDPALASPIG
101 WLMTLTHRRSIDRVRSEQSAADRNHAYGASNLGREHDTVADEVGQRLDEQ
151 EVTDCLDGLTTVQREAIGLAYYSGHTYREVAEHLDVTLPTIKARIRDGLI
201 RLKNCLGVGTDA

>ECFp75779 ECF19 ECF19s11 Nocardia salmonicida NBRC 13393

1 MKARPGSSPIRLRSVTEPAPACPAGAQRDYAVQARLVTLLDDVAAGDRSA
51 FAEFYRATSPRVFGLALRVVRNHGAAEDIAQEVFLQVWSLAGQYDAAKAS
101 PIGWLMMLTHRRAVDRVRAEQSATRRDIVFGHAHLGCDHDIVAEEVTQRL
151 DEQSVLDCLETMTALQREAVALAYYGGRTYVEVSETLAVPLPTVKSRIKD
201 GLKRLENCLTGGGSR

>ECFp75776 ECF19 ECF19s11 Mycolicibacterium mucogenicum

1 MSTPSGSDRLRQIDPVLAQPCDDSRMEGEPDRVALLTAIADGDSAAFTEF
51 YDLTSPRVFGLAYRVVRDRTLAEDVVQEVFLQVWSSAARQYDPALASPIG
101 WLMTLTHRRSIDRVRSEQSAADRNHAYGASSLGREHDTVADEVGQRLDEQ
151 EVTDCLDGLTAVQREAIGLAYYSGHTYREVAEHLAVTLPTIKARIRDGLI
201 RLTNCLGVGTDA

Name Aliases LCA Taxa Group Subgroup
ECFp75641
  • RNA polymerase subunit sigma
  • G361_RS0111945
Nocardia sp. BMG111209 ECF19 ECF19s11

>ECFp75641 ECF19 ECF19s11 Nocardia sp. BMG111209

1 MADDQRFRPTGLDLTGEHPPEPPDSCPVHAGESGADNRQLAAQLARIADG
51 DRDTFTEFYRATQHRVFGLALRVLRRRATAEEVTQEVYLQVWSLAGRYDD
101 RLASPIGWLMMLTHRRAVDRVRSETSAAGRELTYGHRHLGRDHDIVAETV
151 DQRADERAVADCLAVLTATQHETVALAYYGGHTYAEVARRLGIPLNTVKT
201 RIRDGLARLRTCLTGSVTDD

Name Aliases LCA Taxa Group Subgroup
ECFp75638
Mycobacterium sp. 141 ECF19 ECF19s11

>ECFp75638 ECF19 ECF19s11 Mycobacterium sp. 141

1 MDSPRGRDRGTGDRAAESTSAARAANATELARRLGAIAAGDRDAFTEFYD
51 MTCARVFGLSSRIVRNPALAEEVSQEVYLQVWTSAARDYDPTLASPIGWL
101 LTLTQRRSVDRVRSEQSASDRNHAYGATHLGREHDVVADEVGQRLDEQQV
151 VDCLATLTDTQREAIALAYYGGHTYREVAELLGSGLPAIKTRIRDGLIRL
201 KNCLGVGFDG

>ECFp75407 ECF19 ECF19s11 Nocardia xishanensis NBRC 101358

1 MRRYAGENGARATQCSTREAGAAAERSRRLADLLAAVGSGDREAFTEFYR
51 ATSHRVFGLAVRIARSQAAAEEITQEVYLQAWSTAERYDRTRASPIGWLM
101 MLTHRRAVDRVRTEQSTADRDIVYGHSHLGRDHDIVAEEVGQRLDEELVL
151 ECLGTLTSTQREALALAYYSGRTYREVADQLDIPLPTAKSRIRDGLRRLA
201 TCLSGGEPG

Name Aliases LCA Taxa Group Subgroup
ECFp75293
Nocardia crassostreae ECF19 ECF19s11

>ECFp75293 ECF19 ECF19s11 Nocardia crassostreae

1 MTDHDITPVVPPGTDIELSRRLAELIAAVGGGDRAAFTTLYRLTSHRVFG
51 LALRMLRSRAAADEVAQEVYLQVWSLADRYDPHMASPMGWIMMLTHRRAV
101 DRIRSERSAAGRDLVYGHTHLDRDHDAVAEAVEQGFEERAMVRCLGALTE
151 LQRHSIVLAYYGGQTYPEIADHLGTAVSTVKTRIRDGLRRLSACLTEGDL
201 P

Name Aliases LCA Taxa Group Subgroup
ECFp75082
  • RNA polymerase subunit sigma
  • ON31_RS04470
Nocardia otitidiscaviarum NBRC 14405 ECF19 ECF19s11

>ECFp75082 ECF19 ECF19s11 Nocardia otitidiscaviarum NBRC 14405

1 MTEDEHSTVVPLFRDLEQTAVAQPSCPADRPGRDRELAERLVGLLAAVGG
51 GDRAAFTELYRLTSHRVYGLALRMLRNRSTAEEITQEVYLQAWSLAGRYD
101 ERMASPMGWLMMLTHRRAVDRIRMERSATGRESAYGHLHLGRDHDVVLEA
151 VEQSLDEGAVRSCLETLTPLQRETLALAYYSGRTYSEVADHLDTPVPTVK
201 TRIRDGLERLAACLTGGDLR

Name Aliases LCA Taxa Group Subgroup
ECFp74967
  • RNA polymerase sigma factor SigK
  • D892_RS0113200
Nocardia sp. BMG51109 ECF19 ECF19s11

>ECFp74967 ECF19 ECF19s11 Nocardia sp. BMG51109

1 MTDDPGIVSLRLHDGAPPDTADPAPSCPVPGPDGDGNEGGQRELRLLLDA
51 TGTGDRDAFTRFYRATNPRVFGLALRIVRNRTAAEEITQEVYLQVWSTAY
101 RFDPKRATPIGWLMMIAHRRAVDRVRTEKTAFHRDTVYGHTHLGRDHDVV
151 EETVGQQLEEQAVVHCLDTLTSTQREAVALAYYSGRTYREVSQHLDVPLA
201 TIKSRIRDALKRLHTCLSGAVSHA

>ECFp74759 ECF19 ECF19s11 Nocardia amikacinitolerans NBRC 108937

1 MRRDPAANGAGPQCSTRAEGSAAERSRWLADLLAAVGDGDRDAFTDFYRA
51 TSYRVFGLAMRIARSRAAAEEITQEVYLQAWSTAATYDRNRASPIGWLMM
101 LTHRRAVDRVRAEQSTADRDIVYGHSHLGRDHDIVAEEVGQRLDEQSVLD
151 CLGTLTSMQREALALAYYSGRTYREVADQLDVPLPTVKSRIRDGLRRLAT
201 CLSGGESS

>ECFp74757 ECF19 ECF19s11 Nocardia

1 MTARPGSSPIRLRSVTEPAPACPAGAQRDYAVQARLVTLLDDVAAGDRSA
51 FAEFYRATSPRVFGLALRVVRNHGAAEDIAQEVFLQVWSLAGQYDAAKAS
101 PIGWLMMLTHRRAVDRVRAEQSATRRDIVFGHAHLGCDHDIVAEEVTQRL
151 DEQSVLDCLETMTELQREAVALAYYGGRTYVEVSETLAVPLPTVKSRIKD
201 GLKRLENCLTGGGSR

>ECFp74590 ECF19 ECF19s11 Mycobacteriaceae

1 MSTPSGSDGLRRIDTVPARLCDDARMEAEPDRAALLAAIADGDGAAFTEF
51 YDLTSARVHGLAYRVVRNRVLAEDVVQEVFLQVWTTAARQYDPALASPMG
101 WLLTLTHRRSVDRVRSEQSAADRNHVYGVSSLGREHDAVADEVGQRLDEQ
151 EVADCLDGLTTVQREAIGLAYYSGHTYREVAEHLDVTLPTIKARIRDGLI
201 RLKNCLGVGTDA

>ECFp146410 ECF19 ECF19s11 Mycolicibacterium llatzerense

1 MSTPSGSDGLRRIDTVPARLCDDARMEAEPDRAALLAAIADGDGAAFTEF
51 YDLTSARVHGLAYRVVRNRVLAEDVVQEVFLQVWTTAARQYDPALASPMG
101 WLLTLTHRRSVDRVRSEQSAADRNHVYGVSSLGREHDAVADEVAQRLDEQ
151 EVADCLDGLTTVQREAIGLAYYSGHTYREVAEHLDVTLPTIKARIRDGLI
201 RLKNCLGVGTDA

>ECFp76018 ECF19 ECF19s11 Nocardia yamanashiensis NBRC 100130

1 MADEQRGFPVGLDASADETTGPSCPATRPRVDPEDARRLIRLLAAIAEGD
51 RDAFTEFYRATHHRVFGLALRVLRRPASAEEITQEVYIHVWNAAGSYDAA
101 LAGPMGWLMMLTHRRSVDRVRVEASATSRDLAYGHRHLGRDHDIVAETVG
151 QRSDERAVVDCLEVLTATQRETLALAYYGGRTYAEVAAHLGIPLNTVKTR
201 IRDGLKRLQNCLTGSVTDV

>ECFp75510 ECF19 ECF19s11 Nocardia lijiangensis NBRC 108240

1 MSDDAGKRGLIRLRGNPAENGTHASQCSTPDAAATAERNRWLADLLAAVG
51 SGDREAFTEFYRATSHRVFGLAVRIARSQAAAEEITQEVYLQAWSTAERY
101 DRARASPIGWLMMLTHRRAVDKVRTEQSTADRDIVYGHSHLGRDHDIVAE
151 EVDQRLDEQSVLECLGTLTSTQREALALAYYSGRTYREVADQLDVPLPTV
201 KSRIRDGLRRLATCLSGGESS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more