ECF proteins of ECF subgroup ECF12s6

Displaying ECF 41 - 51 of 51 in total
Name Aliases LCA Taxa Group Subgroup
ECFp105778
  • RNA polymerase sigma factor RpoE
  • A3EM_RS0132310
Flexithrix dorotheae DSM 6795 ECF12 ECF12s6

>ECFp105778 ECF12 ECF12s6 Flexithrix dorotheae DSM 6795

1 MIDPKKKDYSEREKVAIFDTEFMPHIDSMYNFAFKLTFDEEDAKDLVQDT
51 YLKAFRFISSFEKGTNAKAWLFRILKNSFINDYRKKSKQPAKVDYQEVET
101 FYNSENTDQNITIDLRSETMQNRIGDEVTNALNSLGVDFRIVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEKLNKYAQSLGYN

Name Aliases LCA Taxa Group Subgroup
ECFp81380
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Jiulongibacter sediminis ECF12 ECF12s6

>ECFp81380 ECF12 ECF12s6 Jiulongibacter sediminis

1 MEAVLEKKPTYSDTERYGIFNSEFMPHIDSMYNFAYRLTNDEDDANDLVQ
51 DTYLKAFRFINSFQKGTNAKAWLFRILKNSFINDYRKKSKEPAKVDYQEV
101 ETIYNSADEPQYNGTVDLRTEMVQDLIGDEVTRALNGLPVDFRTVIILCD
151 IEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRSYATNMGYKELR

Name Aliases LCA Taxa Group Subgroup
ECFp81467
  • RNA polymerase sigma-70 factor, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Cyclobacterium ECF12 ECF12s6

>ECFp81467 ECF12 ECF12s6 Cyclobacterium

1 MSEVQRKKYSDKDKNNIFDHEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEKGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSDNVDYSMTSDLRVDAVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKDKLRSYAENMGYDTEEE

>ECFp86113 ECF12 ECF12s6 Saprospira grandis DSM 2844

1 MEEHSLPDEENQEQEPQKEEREVTAEELQVFNEELMPQINALYNFAYHLT
51 YNEDDANDLVQETYLKAYRFIHRYQAGTNAKAWLFKILKNAFINQYRKKS
101 KRPQKVDYEDIVSYHDTEEASYVDFMDLRQEIFQGMIGDEVTTAINSLAV
151 DFRTVILLCDIEGFTYEEIAKIIDVPIGTVRSRLHRARNMLKEQLRTYAE
201 RLGYKDYRGQKNK

Name Aliases LCA Taxa Group Subgroup
ECFp116428
  • RNA polymerase sigma factor RpoE
  • F752_RS0114085
Nafulsella turpanensis ZLM-10 ECF12 ECF12s6

>ECFp116428 ECF12 ECF12s6 Nafulsella turpanensis ZLM-10

1 MADNDHPQRYSEQKKVQIFDGEFLPHIDAMYNFAYRLTFDEDDAKDLVQE
51 TYLKAFRFINSFEEGTNAKAWLFRILKNSFINDYRKKSKEPNKVDYNEVE
101 TYYNSEDANAEITPDLRVEALQDMIGDEVTNALNSLAVDFRTVIILCDLE
151 GFTYEEMAKILDIPIGTVRSRLHRARNLLKDKLKSYAQSMGY

Name Aliases LCA Taxa Group Subgroup
ECFp94403
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Saprospira grandis str. Lewin ECF12 ECF12s6

>ECFp94403 ECF12 ECF12s6 Saprospira grandis str. Lewin

1 MEEHSLPDEENQEQEPQKEEREVTAEELQVFNEELMPQINALYNFAYHLT
51 YNEDDANDLVQETYLKAYRFIHRYQPGTNAKAWLFKILKNAFINQYRKKS
101 KRPQKVDYEDIVSYHDTEDASYVDFMDLRQEIFQGMIGDEVTTAINSLAV
151 DFRTVILLCDIEGFTYEEIAKIIDVPIGTVRSRLHRARNMLKEQLRSYAE
201 KLGYKDYRGQKNK

Name Aliases LCA Taxa Group Subgroup
ECFp30935
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Dyadobacter ECF12 ECF12s6

>ECFp30935 ECF12 ECF12s6 Dyadobacter

1 MLVAMSETLTTNEYTDDLRYEVFNREFMPHIDSMYNFAFRLTMDEDDAND
51 LVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPSKVDY
101 QEVETTYNSEEASDTTYTVDLRADAVQELIGDEVANALNALPVDFRTVII
151 LCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRSYASSMGYDS

>ECFp31716 ECF12 ECF12s6 Spirosoma linguale DSM 74

1 MATIPEVMSDTPTRDDQDRTGMPDHGMPDHGGPSGPDHLLPDGDAVDQPS
51 ADTPARRYTDEQKYQVFNKEFMPHIDSMYNFAFRLTTDEDDANDLVQDTY
101 LKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPAKVDYQDVETT
151 YNSEDAESEHTVDLRAESVSDLIGDEVATALNSLPVDFRTVIILCDIEGF
201 TYEEMAKILDIPIGTVRSRLHRARNLLKEKLRDYASSMGYNEESEE

>ECFp82167 ECF12 ECF12s6 Flammeovirgaceae bacterium 311

1 MIENEDWEPTGQDYSDEDRSEENRYPNKSKDEDDNDDAADTNDTEENQLT
51 EEATEGDIPVERYSEKQKMRIFDGEFLPHIDAMYNFAFRLTFDEDDAKDL
101 VQETYLKAFRFINSFEEGTNAKAWLFRILKNSFINDYRKKSKEPAKVDYN
151 DVESYYNSEDAQVEMTTDLRVESLRDMIGDEVSNALNSLAVDFRTVIILC
201 DLEGFTYEEMAKILDIPIGTVRSRLHRARNLLKDKLRSYAQSMGY

Name Aliases LCA Taxa Group Subgroup
ECFp31951
  • RNA polymerase sigma factor RpoE
  • SD10_26890
  • ... more
Spirosoma radiotolerans ECF12 ECF12s6

>ECFp31951 ECF12 ECF12s6 Spirosoma radiotolerans

1 MSDTPTRDDQDRTGAPDHGMPDGPDQLLPDGDPVEQPSADTPARRYTDEQ
51 KYQVFNKEFMPHIDSMYNFAFRLTTDEDDANDLVQDTYLKAFRFISSFEQ
101 GTNAKAWLFRILKNSFINDYRKKSKEPAKVDYQDVETTYNSEDAESEHTV
151 DLRAESVSDLIGDEVATALNSLPVDFRTVIILCDIEGFTYEEMAKILDIP
201 IGTVRSRLHRARNLLKEKLRDYASSMGYKEESEE

>ECFp178751 ECF12 ECF12s6 Spirosoma montaniterrae

1 MPDTPTRDDQLLPGDNAAEQPAAETPVRRYTDEQKYQVFNKEFMPHIDSM
51 YNFAFRLTNDEDDANDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSF
101 INDYRKKSKEPAKVDYQDVETTYNSEDAETEHTVDLRAESVSDLIGDEVA
151 TALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLK
201 EKLRDYAASMGYNEESDE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more