ECF proteins of ECF subgroup ECF12s6

Displaying ECF 21 - 40 of 51 in total
Name Aliases LCA Taxa Group Subgroup
ECFp140201
Dyadobacter koreensis ECF12 ECF12s6

>ECFp140201 ECF12 ECF12s6 Dyadobacter koreensis

1 MSVAMSESITTNGYTDDLRYEIFNREFMPHIDSMYNFAFRLTMDEDDAND
51 LVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPSKVDY
101 QEVETTYNSEEASDTTYTVDLRADAVQELIGDEVANALNALPVDFRTVII
151 LCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKSYASSMGYDS

>ECFp140241 ECF12 ECF12s6 Spirosoma endophyticum

1 MATIHEVMSDTPTRDEDQLLPDGEPIEQPSADTPARGYTDEQKYRIFNKE
51 FMPHIDSMYNFAFRLTTDEDDANDLVQDTYLKAFRFISSFEQGTNAKAWL
101 FRILKNSFINDYRKKSKEPAKVDYQDVETTYNSEDAESEHTVDLRAESVS
151 DLIGDEVATALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVRSRL
201 HRARNLLKEKLRDYASSMGYKEENEE

Name Aliases LCA Taxa Group Subgroup
ECFp140384
  • RNA polymerase sigma factor RpoE
  • X939_RS0114650
Dyadobacter tibetensis Y620-1 ECF12 ECF12s6

>ECFp140384 ECF12 ECF12s6 Dyadobacter tibetensis Y620-1

1 MIVAMSETLAKNENTDDLRYDIFNREFMPHIDSMYNFAFRLTMDEDDAND
51 LVQDTYLKAFRFIKSFEQGTNAKAWLFRILKNSFINDYRKKSKEPSKVDY
101 QEVETTYNSEEASDTTYTVDLRADAVQELIGDEVANALNALPVDFRTVII
151 LCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRSYANTMGYDS

>ECFp140395 ECF12 ECF12s6 Arsenicibacter rosenii

1 MATMPELMSDTPARGYSEDQKYLIFNKEFMPHIDSMYNFAFRLTMDEDDA
51 NDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPAKV
101 DYQDVETTYNSEDAEAEHTVDLRAESVSDLIGDEVATALNSLPVDFRTVI
151 ILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRDYAKSMGYRE
201 ENED

>ECFp148004 ECF12 ECF12s6 Algoriphagus

1 MSEVQRRKYSQEEKNSIFDGEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEQGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSDDVDFRGTTDLRAESVKDMIGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKGYAQHMGYNTDEEE

Name Aliases LCA Taxa Group Subgroup
ECFp178778
Spirosoma sp. 48-14 ECF12 ECF12s6

>ECFp178778 ECF12 ECF12s6 Spirosoma sp. 48-14

1 MSDTPTSDRNRIGGPTGPDQFLPDSDSAEQPLANAPSRGYSEEQKYQIFN
51 KEFMPHIDSMYNFAFRLTMDEDDANDLVQDTYLKAFRFISSFEQGTNAKA
101 WLFRILKNSFINDYRKKSKEPAKVDYQDVETTYNSEDAESEHTVDLRAES
151 VSDLIGDEVATALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVRS
201 RLHRARNLLKEKLRDYASSMGYKEENDE

>ECFp150623 ECF12 ECF12s6 Algoriphagus ornithinivorans

1 MSEVQRRKYSQEEKNSIFDGEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEQGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSDDVDFQGTTDLRAESVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKGYAQHMGYNTDEEE

>ECFp151628 ECF12 ECF12s6 Cyclobacterium halophilum

1 MSEVQRKKYSDKEKNSIFDHEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEKGTNAKAWLFRILKNSFINEYRKKSKQPSKVDYQEVET
101 YYNSDSVDYTMTSDLRVDAVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKDKLRSYAENMGYDTEEE

>ECFp165315 ECF12 ECF12s6 Algoriphagus alkaliphilus

1 MSEVQRRKYSQEEKTAIFDGEFMPHIDSMYNFAFRLTFDEDDAKDLVQDT
51 YMKAFRFINSFEKGTNAKAWLFRILKNSFINEYRKKSKQPTKVDYQEVET
101 FYNSDDVDYQSTSDLRAESVKDMLGDEISNALNALAVDFRTVIILADLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEQLKGYAQSMGYNTNEEEED

>ECFp168084 ECF12 ECF12s6 Algoriphagus zhangzhouensis

1 MSEVQRRKYSQVEKNSIFDGEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEQGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSDDVDFQGTTDLRAESVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKGYAQHMGYDTDEEE

Name Aliases LCA Taxa Group Subgroup
ECFp29891
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • FAES_4992
  • ... more
Fibrella aestuarina BUZ 2 ECF12 ECF12s6

>ECFp29891 ECF12 ECF12s6 Fibrella aestuarina BUZ 2

1 MSTMPETMSDSTPSPTRGYTEEQKYQIFNKEFMPHIDSMYNFAFRLTTDE
51 DDANDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEP
101 AKVDYHDVETTYNSEDSETEHTVDLRAETVSDLIGDEVATALNSLPVDFR
151 TVIILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRDYAASMG
201 YNENLDD

Name Aliases LCA Taxa Group Subgroup
ECFp29976
  • RNA polymerase sigma factor RpoE
  • B050_RS0119210
Echinicola pacifica DSM 19836 ECF12 ECF12s6

>ECFp29976 ECF12 ECF12s6 Echinicola pacifica DSM 19836

1 MSEVQKKKYSDKEKNSIFDNEFMPHIDSMYNFAFRLTFDEDDAKDLVQDT
51 YLKAYRFINSFEQGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSESVDYSITSDLRVDAVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKEKLHSYAKDMGYDTEEE

Name Aliases LCA Taxa Group Subgroup
ECFp29988
  • RNA polymerase sigma factor RpoE
  • G395_RS0108340
Dyadobacter alkalitolerans DSM 23607 ECF12 ECF12s6

>ECFp29988 ECF12 ECF12s6 Dyadobacter alkalitolerans DSM 23607

1 MLVAMSETLTTNEYTDDLRYEVFNREFMPHIDSMYNFAFRLTMDEDDAND
51 LVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPSKVDY
101 QEVETTYNSEEASDTTYTVDLRADAVQELIGDEVANALNALPVDFRTVII
151 LCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKSYASSMGYDS

Name Aliases LCA Taxa Group Subgroup
ECFp29966
  • RNA polymerase sigma factor RpoE
  • RUDLU_RS0110790
Rudanella lutea DSM 19387 ECF12 ECF12s6

>ECFp29966 ECF12 ECF12s6 Rudanella lutea DSM 19387

1 MSDTPTRDEQDRPNGPTGPDQTLPEGVSADGTPTEAPVRRYTDEQKYAVF
51 NKEFMPHIDSMYNFAFRLTMDEDDANDLVQDTYLKAFRFISSFEQGTNAK
101 AWLFRILKNSFINDYRKKSKEPAKVDYQDVETTYNSEDAETEHTIDLRAE
151 SVSDLIGDEVATALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVR
201 SRLHRARNLLKEKLRDYAASMGYREQNEE

>ECFp30290 ECF12 ECF12s6 Spirosoma spitsbergense DSM 19989

1 MSDTPTRDDDQLLPNGDAVQQTPDETPARRYTDEQKYQVFNKEFMPHIDS
51 MYNFAFRLTMDEDDANDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNS
101 FINDYRKKSKEPAKVDYQDVETTYNSEDAESEHTVDLRAESVSDLIGDEV
151 ANALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLL
201 KEKLRDYASSMGYKEENGD

Name Aliases LCA Taxa Group Subgroup
ECFp31043
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Fibrisoma limi BUZ 3 ECF12 ECF12s6

>ECFp31043 ECF12 ECF12s6 Fibrisoma limi BUZ 3

1 MATMPEIMSDTPTRGYTEDQKYQIFNKEFMPHIDSMYNFAFRLTMDEDDA
51 NDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPAKV
101 DYQDVETTYNSEEAEVEHTVDLRAEAVSDLIGDEVATALNSLPVDFRTVI
151 ILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRDYASSMGYNE
201 ENEE

Name Aliases LCA Taxa Group Subgroup
ECFp31073
  • RNA polymerase sigma factor RpoE
  • Q369_RS0120830
Dyadobacter ECF12 ECF12s6

>ECFp31073 ECF12 ECF12s6 Dyadobacter

1 MLVAMSETLTTNGYTDDLRYEVFNREFMPHIDSMYNFAFRLTMDEDDAND
51 LVQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKKSKEPSKVDY
101 QEVETTYNSEEASDTTYTVDLRADAVQELIGDEVANALNALPVDFRTVII
151 LCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKSYASSMGYDS

Name Aliases LCA Taxa Group Subgroup
ECFp31350
  • RNA polymerase sigma factor RpoE
  • B156_RS0101405
Spirosoma luteum DSM 19990 ECF12 ECF12s6

>ECFp31350 ECF12 ECF12s6 Spirosoma luteum DSM 19990

1 MSDTPTRDDDQLLPNGDAVEQTPAETPARRYTDEQKYQVFNKEFMPHIDS
51 MYNFAFRLTMDEDDANDLVQDTYLKAFRFISSFEQGTNAKAWLFRILKNS
101 FINDYRKKSKEPAKVDYQDVETTYNSEDAESEHTVDLRAESVSDLIGDEV
151 ANALNSLPVDFRTVIILCDIEGFTYEEMAKILDIPIGTVRSRLHRARNLL
201 KEKLRDYASSMGYKEENGD

Name Aliases LCA Taxa Group Subgroup
ECFp31570
  • RNA polymerase sigma-70 factor, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Lunatimonas lonarensis ECF12 ECF12s6

>ECFp31570 ECF12 ECF12s6 Lunatimonas lonarensis

1 MSEVQRKKYSERDKNSIFDQEFMPHIDSMYNFAYRLTFDEDDAKDLVQDT
51 YLKAYRFINSFERGTNAKAWLFRILKNSFINEYRKKSKQPAKVDYQEVET
101 YYNSDNVDYNMTSDLRVDAVKDMLGDEISNALNSLAVDFRTVIILCDLEG
151 FTYEEMAKILDIPIGTVRSRLHRARNLLKDKLKDYAQHMGYDTEGEED

Name Aliases LCA Taxa Group Subgroup
ECFp80031
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Flammeovirga pacifica ECF12 ECF12s6

>ECFp80031 ECF12 ECF12s6 Flammeovirga pacifica

1 MSETTKKTLSTEERMEVFDREFAPHTDSMYSFAYRLTGDDEDAKDLVQDT
51 YMKAYRFIDSFEEGTNAKAWLFRILKNSFINEYRKKSKEPSKIDYQEVET
101 IYNGEKNDPSVISGMRQDNSKYKIGDEVTTALNALAVDFRIVIILCDLEG
151 FTYEEMSKILDIPIGTVRSRLHRARNLLKEKLESYAKKMGYSQKKAN

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more