ECF proteins of ECF subgroup ECF12s5

Displaying ECF 61 - 70 of 70 in total

>ECFp87667 ECF12 ECF12s5 candidate division Zixibacteria bacterium RBG_16_48_11

1 MPEELLSSKPSEFEKAALVHLNSVFAVARRMTKNQTDAEDLVQETYLKAY
51 RFFHRFQPGTNCRAWLLRILTNIFINKYRQKAREPQSVEFQQAEEYRLNQ
101 QLLAPNRNPDPEESLWSQVGKEQIKKALETLPEEFRLAVVLCFVEGFSYD
151 EIAEILGVRLGTVKSRIHRGRLLLKTQLLNYAQQMGLLKE

>ECFp89834 ECF12 ECF12s5 Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10

1 MSLFRRRKDAPGRFEALVLPHLDALYGAAVRMTRHRQDAEDLVQETCLRA
51 YRFLDRLEDEGRCRAWLFRILTNTFINLYRRAQRAPETVALEEGETEVRA
101 SEGEVSLEAVMDDELKAALDALPDEYRVAVLMSDVEAFTYDEIAEILGCP
151 VGTVRSRIHRGRNLLRTHLLRAAGRRGGQQGGGYA

>ECFp92587 ECF12 ECF12s5 Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10

1 MYLFRRRKDAQGRFEALVLPHLDALYGAAVRMTRHRQDAEDLVQETCLRA
51 YRFLDRLEDEGRCRAWLFRILTNTFINLYRREQRAPEMVALEESGVEAAA
101 SGEEVSLEAVMDDELKAALDALPDDYRTAILLSDVEEFSYEEIAGMLGCP
151 IGTVRSRIHRGRNLLRANLIRAAGRGGDLQGGSYA

>ECFp94224 ECF12 ECF12s5 Nitrospirae bacterium RBG_16_64_22

1 MTNPSASPSRSERFEAEALVHLGPLYRTALRLTGNDADAQDLVQETVLRA
51 FRFFDSFEPGTNCRAWLFRILMNTFVNEYRKRVRGPQQVDLDETTMGTLE
101 SRADQAIVSLPATPEEVVSAGMLDGDLKEGLRALPPEFRAAVLLCDVEEF
151 SYKEIAEMTQVPVGTVMSRIHRGRRALREFLLRRRRAKPVRALSAGA

>ECFp94431 ECF12 ECF12s5 Deltaproteobacteria bacterium RBG_16_71_12

1 MTLGSLFTRASTKDRAFEREAMPHMRSLYGAAMRLVRSPDDASDLVQETM
51 LKAYKAWDQFETGTNCKAWLFRIQTNAFINKYRRRVKEREILEGPERQAA
101 EHNLVHLPSKRAFLDPEGELVDRTLGDEVLKALDTVPEDFRTVVMLSDVE
151 GFSYKEIADLCEIPVGTVMSRLFRGRRILQEQLFA

>ECFp98524 ECF12 ECF12s5 Myxococcales bacterium SG8_38

1 MPKKERKIAATRRLFEGEVRPHLDALYSTALRLTRSPVDAEDLVQDTLVR
51 AYRFYDRFEAGTNFKAWLLRIQMNAFVNRYRRAARERQVFDGPMAAPVGE
101 GVMSRSTMRGLTDPVGDAQRQIIAREISRAFEELSDDARAMVLLADVEEL
151 SYKEIAEVIGCPIGTVMSRLHRARKQLQSSLRHHAVQLGIVDTDEDEVDD
201 PVSLEAFRSRKAVKP

Name Aliases LCA Taxa Group Subgroup
ECFp31307
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Anaeromyxobacter sp. Fw109-5 ECF12 ECF12s5

>ECFp31307 ECF12 ECF12s5 Anaeromyxobacter sp. Fw109-5

1 MFDLRQTDLTRGEFEELALKHLDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNMKAWLFKILTNTFINRYRRSVKERNIVEGSERDAVHER
101 FVSREAAEFAANPEQYFFDRLLSDDVLKAVDSLPIDFRLVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVLSGVLQEVGEDGSID
201 LETYRKRRGKSA

>ECFp31622 ECF12 ECF12s5 Anaeromyxobacter

1 MFDLRQNDLTRDEFQELALKHIDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRSVKERNIVEGSERDAVHER
101 FVSREAAEYAANPEQYFFDRLLSDDVLKAVDSLPIDFRMVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVVSGVIQLPESEDGES
201 IDLETYRRRRGKSA

Name Aliases LCA Taxa Group Subgroup
ECFp106635
  • RNA polymerase sigma-70 factor, ECF subfamily
  • hypothetical protein
  • ... more
Sandaracinus amylolyticus ECF12 ECF12s5

>ECFp106635 ECF12 ECF12s5 Sandaracinus amylolyticus

1 MALSDDTPNPLRDEFAKEALVHLDSLYGAALRLTRSESDAEDLVQDAFLK
51 AYRFYDRFEPGTNLRAWLLRVLTNTFINKYRRNTRERRVLDGDEAEPVGD
101 GVMSRAAMRALTDPVGDAMRPLVVKEIQNALDELSDEHRLMIVLADVEEL
151 SYKEIADIVGCPIGTVMSRLHRARKQMQHRLVDTAVQMGIIDDKTEGTSE
201 PISLEAYRRTREVAG

>ECFp150851 ECF12 ECF12s5 Planctomycetes bacterium RBG_16_43_13

1 MAKAAKRKEFEDIVLGYADALYNMALKLTKERSTAEDLVQETYEKAYKNF
51 HQFEKGTNIKAWLFTIMTNTYINQYRRKSREPAVLDFTTMDSGDADKETT
101 YFSLDDIDAMKEKLGDEPKRALEKLAPEYRMVFLLSTFEGFSYKEIAEIT
151 GCPLGTVMSRLFRAREFMKNELSNYARSEGILRYRN

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more