ECF proteins of ECF subgroup ECF12s5

Displaying ECF 41 - 60 of 70 in total
Name Aliases LCA Taxa Group Subgroup
ECFp61848
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Sphaerobacter thermophilus DSM 20745 ECF12 ECF12s5

>ECFp61848 ECF12 ECF12s5 Sphaerobacter thermophilus DSM 20745

1 MNQEQSEIPRAKLQEEALSHIDALYRTAYRMTGNAMDAEDLVQETYLRAF
51 RSLHQFRPGTNLRAWLFKILTNAFINDYRKRSRRPRSTSLDNVEDYYLYS
101 HLIDSGIQPASTRPEDEVLANIPDEAVIAALESLPDEFRQVVLLADVEGF
151 SYREIADIMSTPVGTVMSRLHRARRRLQGAILKACTAAACSVGSDGDACD
201 ARLR

>ECFp62323 ECF12 ECF12s5 Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22

1 MISEGASIRWGTRAGRSREFEEVALVHLDALYRSALRLTQNRAEAEDVVQ
51 ETCLRAFRSFHRFNPGTNCRAWLFTILRNAFLNRVRGAGREVHEGDAAEG
101 WDALVQRSAEHRPGGGSPEEEFFQTVLHGDVDRALKALPLTFREAVVLAD
151 LEGLSYKEIAEIIGRPVGTVMSRLSRGRRLLRRALGDFAREHGYVGEPE

>ECFp62874 ECF12 ECF12s5 Candidatus Rokubacteria bacterium RIFCSPHIGHO2_12_FULL_73_22

1 MIGWRPGQDRSREFEAVALVHLDALYRSALRLTQNRAEAEDVVQDTFLRA
51 FRSFHRFNPGTNCRAWLFTILRNTFLNRVRGAGREVHEGESAEGWDALLE
101 RSAERRPGAGNPEEELLQTALHGDVDRALRALPLAFREAVVLVDLEGLSY
151 KEVAEIVGCPVGTVMSRLSRGRRLLRRALGDFAREHGYVGEPE

>ECFp64714 ECF12 ECF12s5 Gemmatimonas sp. SG8_38_2

1 MATDGSPKRQQFESEALVHLDTLYNVALRLCGNASDAEDLVQDTVTKAFR
51 AWDKYEPGTNCRAWLVTIMRNTFINKFRRESRRPSAVQFDTIEDVSVFES
101 VQDQDPEGSFFHSVVDDEVKRAIQDLPEEFRIPVVLSDVEGMSYAEIANI
151 LDLPVGTVKSRLFRGRRRLQQRLYEYALEMGYIR

Name Aliases LCA Taxa Group Subgroup
ECFp65009
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-E factor
  • ... more
Nitrolancea hollandica Lb ECF12 ECF12s5

>ECFp65009 ECF12 ECF12s5 Nitrolancea hollandica Lb

1 MSDNPNIDHPDQNSTTALQEEALSHIDALYRTAYRMSGNPADAEDLVQET
51 YLRAFRSLHQFRAGTNLRAWLFKILTNAFINEYRKRSRQPRSTSLDDVED
101 YYLYTHLIDSGIQPTASRPEEEVLASITDDDVLRALESLSVEFREVVLLA
151 DVEGFSYREIAEIMDIPVGTVMSRLHRARRRLHQSLVGTPIASGRADGDG
201 TDA

>ECFp65404 ECF12 ECF12s5 Candidatus Entotheonella factor

1 MFIGDVREVEGTVVVEDREAKQMREAFEALALEHFDALYNTAVRLTRNPS
51 EAQDLVQETFLKAFRFYHRFEPGTNLKAWLFTILRNTYINVYRKAARQQQ
101 VDFDQVAPFYADTADPPAWTDRGTMEEMLRHLVQDDVKRALESLPDEYRM
151 VVLLADLEDFAYKEIAKIVGCPVGTVMSRLFRGRRLLRKSLAEFAKKSGY
201 IKE

>ECFp669 ECF12 ECF12s5 Anaeromyxobacter dehalogenans 2CP-C

1 MFDLRQNDLTRDEFQELALKHIDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRSVKERNIVEGSERDAVHER
101 FVSREAAEYAANPEQYFFDRLLSDDVLKAVDSLPIDFRMVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVVSGVIQLPESDDGES
201 IDLETYRRRRGKSA

Name Aliases LCA Taxa Group Subgroup
ECFp78095
  • RNA polymerase subunit sigma-24
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Actinobacteria bacterium IMCC26256 ECF12 ECF12s5

>ECFp78095 ECF12 ECF12s5 Actinobacteria bacterium IMCC26256

1 MAPRHAASGPEPLGVGPGAKSQHECPRVAVTSRAVANQEDFEVLAMQYAG
51 EIYAHALRLTSDKADAEDLVQETFLKGYRGFAGFESGSNLRAWLYRIATN
101 SYINGYRAKKRRPETRDIDSMGEWALHQRIGGLEKAASDVTPESIVMESI
151 TDAAVKAALDALPDDFKQPVLLADVDGFSYREIAEILDIPIGTVMSRLSR
201 GRKRLEVALFSLAVERGLVEPNPEPESVSV

>ECFp81902 ECF12 ECF12s5 candidate division Zixibacteria

1 MLKLKKTQKKLSEFEQVALVHIDSVYNVALRMTKNTSDAEDLVQETYLKA
51 FRFFNKFQAGTNCKAWLLKILTNLFNNKYRQRIKEPPQVSYDEVEEDFLY
101 SLLLKETLEPNENPERILFSQIVEDDVKKVMDNLPEEFRMVVILSFIEDC
151 SYKEIAEIMDTNIGTVKSRLHRGRVMLQKSLYEYAKKRGFVKE

Name Aliases LCA Taxa Group Subgroup
ECFp82653
  • hypothetical protein
  • EG19_07140
Thermoanaerobaculum aquaticum ECF12 ECF12s5

>ECFp82653 ECF12 ECF12s5 Thermoanaerobaculum aquaticum

1 MSANLWADFSELPFREQLLKTALRLTRNREDAEDLVQETYLKAFRHWGRF
51 QPGTNLKAWLFKIMKNTFINLYRRQKAVPPQADFAELEETMEGQILSEPE
101 KSPEDELLERSWDQEVLAAIKSLPHSYKVVVLLSDIEGYSYKEIAEILAI
151 PLGTVMSRLYRGRRALEKALLAFGQRHNYLRHAPRRLRSGDLVGKEKAAK
201 TEDKHLQ

>ECFp84336 ECF12 ECF12s5 candidate division Zixibacteria bacterium RBG_16_53_22

1 MGDVHLDNSMTENRAEQAKKKEFEELFLPLLDNLYSIALRMTRNEKDAED
51 LVQETYLKAFRFFHRFERGTNARAWVLTILTNTFRTRYRKKKQEPSMVDF
101 EAVENFCLADEMVKEITASDKSVAQGAEIVTAILKDYVSDDVIEALENVP
151 EQFRMAVLLSDVEGFSYQEISEILGISVGTVKSRIFRGRKILQKQLWEFA
201 KQRGILKGK

>ECFp84559 ECF12 ECF12s5 Acidobacteria bacterium RBG_13_68_16

1 MNGQTSWDFKNAELPFRDQLYKTAVRLTRSAEDAEDLLQETYLKAYRHYA
51 SFEPGTNLKAWLFKILKNTFINEYRRRKQLPAQVDFAEFEETFESALVAT
101 DARVTRSPEEELLEASLDAEVRTSLTALPHNYKVVVLLADIEGYAYKEIA
151 DILAIPVGTVMSRLYRGRRLLEKALLSFGVRYNYLHHRPHRLRSENLDVE
201 NLFGKGAAAPAHTRVH

Name Aliases LCA Taxa Group Subgroup
ECFp85857
  • RNA polymerase sigma-70 factor
  • hypothetical protein
  • ... more
Candidatus Brocadia sinica ECF12 ECF12s5

>ECFp85857 ECF12 ECF12s5 Candidatus Brocadia sinica

1 MREENNRRKEFEEIALTHIDSLYNMALRLVFNKEEAEDLVQETYLKAYRF
51 FDTFQTGTNIKAWLFKILRNTFINKYRKSASMPGEVFLEDIESVNTNMAY
101 DQEAKSEEAIDTLESKYTDLSSLLDDDVKRAIDSLPIEYREAILFSDVEE
151 LSYKDISEITNVPIGTVKSRLNRGRKLLQKSLWEYAKDRGFIKRGK

Name Aliases LCA Taxa Group Subgroup
ECFp86518
  • RNA polymerase sigma-70 factor, ECF subfamily
  • Cabys_12
Caldithrix abyssi DSM 13497 ECF12 ECF12s5

>ECFp86518 ECF12 ECF12s5 Caldithrix abyssi DSM 13497

1 MTRDRQKEFAELIEPHLSSLYNTALRMTHNQHDAEDLVQDTLFKAYRALD
51 QFQKDTNFRAWVFRILVNTFITAYRKTIRQPQKVSYDEMEEFFLYKRLDE
101 TVSMQEVPKEEFLENLFDDDVKEALDNLPYQFRLVVLLCDVEGFSYQEIS
151 EIIDAPLGTVMSRLYRGRKLLQRYLWNYAKERGYITDEFKPKK

>ECFp86679 ECF12 ECF12s5 Candidatus Fermentibacter daniensis

1 MQEGQGDRFEVEVLQYLDGLYGYAIHLTRNPEDASDLVQETYARAFKARS
51 QYRLGTNARAWLFAILRNTFLNDRRSACRSPRTVSCEWLDELAGEDQDGF
101 ESPRSPDPQKSFIAGLMREDIEKALNELPEEFRSAVVLCDVEEMSYSEIS
151 QILGIPIGTVRSRIHRGRAILRKLLVEWQSSMEGSGGEVLKGG

>ECFp86783 ECF12 ECF12s5 Gemmatimonas sp. SM23_52

1 MSEQAAHRRQEFEREALVHLDTLYNVAVRLCGNASDAEDLVQETVAKAYR
51 AWDKYERGTNCRAWLVTILRNTFINQYRRESKRPSPVEYESVEETSVFES
101 VQDRDPEGSFFRYIVDDEVKRAIQELPEEFRIPLVLSDVEGMSYAEIAEA
151 LELPVGTVKSRLFRGRRRLQQRLYEYALEMGYIR

>ECFp86975 ECF12 ECF12s5 Nitrospinae

1 MEDKKREDFKHTAVPYFNIIYNSAYRMTGNKADAEDLVQDVFLSAYKSFH
51 QFESGTNCRAWLFKILKNTFINKIKKAGREAKQVRELGGSAVREFNSSTP
101 VDKGLDETIQNALNRLPEEFRMAIVLCDVEGFSYQEISEIMECPVGTVRS
151 RISRGRQLLAEDLSAYSRQLLP

>ECFp86963 ECF12 ECF12s5 Myxococcales bacterium SG8_38_1

1 MRPRPRKIATERRLFETEARPHLDTLYSTALRLTRSPVDAEDLVQDTLVR
51 AYRFYDRFEAGTNFKAWLLRIQMNAFVNRYRRSIRERQVFDGPMAAPVGE
101 GVMSRATMRGLTDPVGDAQRQIIAREINRAFEQLSEDARAMVLLADVEEL
151 SYKEIAEVMGCPIGTVMSRLHRARKQLQVSLQQHAVQLGIIEADEDSEED
201 PVSLEAFRSRKAVKS

>ECFp87602 ECF12 ECF12s5 Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10

1 MTMGEGLHQVSPAFEAGALALVDSLYRAALRLTRVPTDAEDLVQETYLKA
51 FRAAGRFEPGTNLRAWLFTILHNTARNRARDRGRDTVDVDSEVVERAADT
101 RAFGAGRSGTPETPETLLLRDTMAPELQAAVDALPDAFRQAVWLRDVEEF
151 SYAEIAAMLAIPVGTVMSRISRGRRALYERLRSAQSVTGRPAPAGVIDD

>ECFp87574 ECF12 ECF12s5 candidate division KSB1 bacterium RBG_16_48_16

1 MVTDENVYSLECKKIFEELSLQYMDLLYSTALRMTKNTEEAEDLVQDSYL
51 RAYRFFHKFEQGTNFKAWIFRILTNTFINRYRKKLRTPKKVELDKVSFFI
101 EDEEAIRDLDINNGSDDPSYGELFDDDINRALNKLSDDFRQIILLADVEG
151 LSYKEIAKKANIPIGTVMSRLFRGRRMLQKKLFKYALKEGYVHSDSIEL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more