ECF proteins of ECF subgroup ECF12s5

Displaying ECF 21 - 40 of 70 in total

>ECFp163446 ECF12 ECF12s5 Deltaproteobacteria

1 MLDFKHTDRTRREFESLSLDHLDALYSAGLRLTKNERDAEDLVQDTFLRA
51 FRFFDKFERGTNMKAWLFKILTNTFINKYRRRVKERTVVEGAAREAGNER
101 FVTREPTESSADPEQYFFDKLLSDDVIRSIDQLPIDFRLVVILADLQEFS
151 YKEIAEILDCPVGTVMSRLYRGRKLLQKNLLEYAVASGVLHGKQALELGA
201 VVEEEEAVEVLEFKRRA

>ECFp164982 ECF12 ECF12s5 Chloroflexi

1 MPEQPNSEREQITQPETNDQNVPPEDFEAGVLNQLDSLYRTARRMTSNQQ
51 EAEDLVQETMLKAFRFANTYQRGTNLRAWLFRILNTSAINRYRKQASHPT
101 PTSLPEGEDFYLYNRIKDLTGQELSIGAEDEVLSQYLDEDVYKALNDLPP
151 NFRMAVILADIEGLSYKEIAEALQIPIGTVMSRISRARRQLQQSLWQYAK
201 ERGYVRSEVK

>ECFp166821 ECF12 ECF12s5 Acidobacteria bacterium 13_1_40CM_4_65_8

1 MPSREGLDAVSVSFEVEALASLDSLYRTALRLTRVPADAEDLVQETYLKA
51 FRAADQFEPGTNLRAWLFTILHNTARNRVRDRARDSVVIDSEAVERAAEV
101 AAFPGATSSPAPETPESLLLRDTLAPELQAAINALPDAFRQAVWLRDVEE
151 FSYAEIARMLDIPVGTVMSRISRGRHLLYEQLHHLRPVNA

>ECFp167336 ECF12 ECF12s5 Acidobacteria bacterium 13_1_40CM_65_14

1 MPSREGLDAVSASFEVEALASLDSLYRTALRLTRVPADAEDLVQETYLKA
51 FRAADQFEPGTNLRAWLFTILHNTARNRVRDRARDSVVIDSEAVERAAEV
101 AAFPGATSSPAPETPESLLLRDTLAPELQAAINALPDAFRQAVWLRDVEE
151 FSYAEIARMLDIPVGTVMSRISRGRHLLYEQLHHLRPVNA

>ECFp167490 ECF12 ECF12s5 Chloroflexi

1 MDQRGVGMDSDFSLFERHVDALYRSALRLTRKPEDAEDLVQETYLRAYRY
51 RNRFKPGTNEKAWLFTIMTNVFRNRLRQRPAPTEPLDQPGTDFSIYDQLR
101 REGMPVHLMSPEEIIVERGFGDEVKRALEELPLPMRMVVVLVDVEDFSYK
151 EVASILGIKIGTVMSRLHRGRQALQKKLWEYSGRPKARPVAVGAH

>ECFp167961 ECF12 ECF12s5 Chloroflexi bacterium 13_1_40CM_2_70_6

1 MGRDAFEVDALSHIDALYRTALRMTRSEADAHDLVQETYVRALRFRAQFT
51 PGTNLKAWLFRILTNTFINEYRKRSRAPETTELDDVDEFSLYRRMSRDRP
101 ASSTDPEQEFLDGIVSTEVKDALGALPEKFRATVLLDVEGFSYKEIAEML
151 EIPIGTVMSRLHRGRKFLQRRLIELARERGIAALRAAPRSD

>ECFp178712 ECF12 ECF12s5 Dermabacter sp. HMSC08H10

1 MSENEKFPGPGNDVEDAVERDAQAAAAQADTESPTTLSPEDFENEALSHI
51 DALYSGALRLTRHQHDAEDLVQDTYVRAFRASTSFKAGTNMRAWLFRIMH
101 NAFISSYRKAQRRPKESGGEQVEDWQLARAASHDSTGLRSAEAEALALLP
151 EGDIQDALNDLRDDYREAVYLADVEGFSYKEIAEIMGTPIGTVMSRIHRG
201 RGLLRASLEQYARERGYLRDADSAAGEETQA

Name Aliases LCA Taxa Group Subgroup
ECFp178500
Urmitella timonensis ECF12 ECF12s5

>ECFp178500 ECF12 ECF12s5 Urmitella timonensis

1 MLSEPALAENPVSEENKAHFDKSQLAQRFTQEALPLLDQLYAGALRLTRR
51 SADAEDLVQDTYMQAFRKFHQYQAGTNLKAWMYRIMTNTFLNQYRSKTRR
101 PQEETTAEISDSRQVQHSLHHQIGLPSAETVALERVPNETIQAAFDKLSD
151 EHRAVVYLADIEQFSYKEISQILGIRLGTVMSRLHRGRNLLREELAEYAR
201 QYGIGVN

>ECFp115239 ECF12 ECF12s5 Armatimonadetes bacterium RBG_16_67_12

1 MGACVVSTNHSGLTVTSEEHERFEALVSRHLDGLYGTALRLTRNRTTAED
51 LIQDTFLKAWRSFRTFQEGTNARAWLYKILMNAYIDSYRRSARAPEMVDQ
101 EDVGDFYLYAKAQDSEELKRAGDPEEILLSKIMDADVKEALEQVPEPFRA
151 AVILADLQDFSYREIADILDIPIGTVMSRLYRGRRHLQRLLWDYARRVGY
201 ADGDAPASPARA

>ECFp181812 ECF12 ECF12s5 Bacteria

1 MGHGMASTPTPPPTPTPAADAEKRASFEREALVHLDSLYRVALRLTGNPA
51 EADDLVQETMLKAYRAWHQFEQGTNAKGWLLTILRHAFINEYRRRTRHPE
101 TVDLDAIEPFSVFEELQDEDPQGTFFDRIVDDEVLRAIDALPEQFRETVV
151 LSDVEGLSYEEIARVLEVPVGTVKSRLFRARRMLQAKLYDYAVGMGYIKG
201 SST

>ECFp178620 ECF12 ECF12s5 Chloroflexi bacterium 13_1_40CM_4_68_4

1 MAEDKKPERLPGEGREPDAFEKEALSYLDALYRTALRMTKDPDEASDLVQ
51 ETYIRALRFRHQFQPGTNLKAWLFRILTNTFINMYRRKASRPQFTDVEGL
101 DEYVLYNKMAELRSPASGSDPEREVLDNLMDTEVKQALDDLPEHFRTAVL
151 LADIEGFSYKEIADILHIPIGTVMSRLHRGRRFLQRRLYDYAKERGIGHG
201 PRPAPQTAS

>ECFp31534 ECF12 ECF12s5 Dermabacter hominis 1368

1 MSENEKFPGPGSDVEGAVERDEQAAAAQADTESPTTLSPEEFEHEALSHI
51 DALYSGALRLTRHQHDAEDLVQDTYVRAFRASTSFKAGTNMRAWLFRIMH
101 NAFISSYRKAQRRPKESGGEQVEDWQLARAASHDSTGLRSAEAEALALLP
151 EGDIQDALNDLRDDYREAVYLADVEGFSYKEIAEIMGTPIGTVMSRIHRG
201 RGLLRASLEQYARERGYLRDSDSAAGEETQA

>ECFp97478 ECF12 ECF12s5 Candidatus Brocadia fulgida

1 MRDDNTRRREFEEHAMAHVDSLYNMALRMVFNKEEAEDLVQETYLKAYRF
51 FDTFQKGTNLKAWLFKILRNTFINNYRKTASMPGEIFFDDIESIQISAPN
101 EEATKSGEAVDTLEKKYNDLGSLLDDEVKSALDSLPIEYREAILLSDVEE
151 LSYKDISEITNVPIGTVKSRLNRGRGLLQKSLLAYAKDRGFIKREK

Name Aliases LCA Taxa Group Subgroup
ECFp30234
  • TIGR02947 family RNA polymerase sigma-70 factor
  • DAD186_13750
Dermabacter vaginalis ECF12 ECF12s5

>ECFp30234 ECF12 ECF12s5 Dermabacter vaginalis

1 MKLPPEQRRVEAMSENEKFPGPGSDVEGAVERDEQAAAAQADTESPTTLS
51 PEDFEHEALSHIDALYSGALRLTRHQHDAEDLVQDTYVRAFRASTSFKAG
101 TNMRAWLFRIMHNAFISSYRKAQRRPKESGGEQVEDWQLARAASHDSTGL
151 RSAEAEALALLPEGDIQDALNDLRDDYREAVYLADVEGFSYKEIAEIMGT
201 PIGTVMSRIHRGRGLLRASLEQYARERGYLRDADSASGEETQA

>ECFp30811 ECF12 ECF12s5 Bacteria

1 MLGHARRREVWSGLEEEALSYMEALYNTALRMTRNEHDAEDLVQDTYLKA
51 FRFCHRFEPGTNLKAWLFKILTNTFINRYRKKKKEPKFTQYDESNPFFLY
101 EKLADRKAGPPSPENGGYALEDLVEDEVVQALEELPSDFRIAVLLSDLEG
151 FSYQEIADIVGCPLGTVRSRLFRGRRLLQQKLWDYAVKRGFVKEKQE

Name Aliases LCA Taxa Group Subgroup
ECFp30950
  • RNA polymerase sigma-70 factor, ECF subfamily
  • RNA polymerase subunit sigma-24
  • ... more
Vulgatibacter incomptus ECF12 ECF12s5

>ECFp30950 ECF12 ECF12s5 Vulgatibacter incomptus

1 MFDFRHTNATRREFESLTLEHLDPLYSAALRLTKNERDAEDLVQDTFLRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGAEKETVHER
101 FISRRATEYAANPEQYFFDRLLSDDVLRSIDELPIDFRLVVILADLQDFS
151 YNEIAEIVGCPVGTVMSRLYRGRKLLQKKLKDFARGSGMVSDEAIDAALA
201 PKEPKGPTDLGEFRRKRAAT

>ECFp30954 ECF12 ECF12s5 Dermabacter

1 MSENEKFPDPGNDVEGAVERDGQAAAAQADTESPTTLSPEEFEHEALSHI
51 DALYSGALRLTRHQHDAEDLVQDTYVRAFRASTSFKAGTNMRAWLFRIMH
101 NAFISSYRKAQRRPKESGGEQVEDWQLARAASHDSTGLRSAEAEALALLP
151 EGDIQDALNDLRDDYREAVYLADVEGFSYKEIAEIMGTPIGTVMSRIHRG
201 RGLLRASLEQYARERGYLRDADSAAAEETQA

>ECFp30975 ECF12 ECF12s5 Dermabacter hominis NBRC 106157

1 MSENEKFPGPGSDVEGAVERGEQAAAAQADSESPTTLSPEDFEHEALSHI
51 DALYSGALRLTRHQHDAEDLVQDTYVRAFRASTSFKAGTNMRAWLFRIMH
101 NAFISSYRKAQRRPKESGGEQVEDWQLARAASHDSTGLRSAEAEALALLP
151 EGDIQDALNDLRDDYREAVYLADVEGFSYKEIAEIMGTPIGTVMSRIHRG
201 RGLLRASLEQYARERGYLREADSAAGEETQA

Name Aliases LCA Taxa Group Subgroup
ECFp31558
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Anaeromyxobacter dehalogenans 2CP-1 ECF12 ECF12s5

>ECFp31558 ECF12 ECF12s5 Anaeromyxobacter dehalogenans 2CP-1

1 MFDLRQNDLTRDEFQELALKHIDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNIKAWLFKILTNTFINQYRRSVKERNIVEGSERDAVHER
101 FVSREAAEYAANPEQYFFDRLLSDDVLKAVDSLPIDFRMVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVVSGVIQLPESEDGES
201 IDLETYRRRRGKSA

>ECFp61291 ECF12 ECF12s5 Candidatus Rokubacteria

1 MIGWRPGQDRSREFEAVALVHLDALYRSALRLTQNRAEAEDVVQDTCLRA
51 FRSFHRFNPGTNCRAWLFTILRNTFLNRVRGAGREVHEGESAEGWDALLE
101 RSAERRPGAGNPEEELLQTALHGDVDRALRALPLAFREAVVLVDLEGLSY
151 KEVAEIVGCPVGTVMSRLSRGRRLLRRALGDFAREHGYVGEPE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more