ECF proteins of ECF subgroup ECF12s5

Displaying ECF 1 - 20 of 70 in total

>ECFp150851 ECF12 ECF12s5 Planctomycetes bacterium RBG_16_43_13

1 MAKAAKRKEFEDIVLGYADALYNMALKLTKERSTAEDLVQETYEKAYKNF
51 HQFEKGTNIKAWLFTIMTNTYINQYRRKSREPAVLDFTTMDSGDADKETT
101 YFSLDDIDAMKEKLGDEPKRALEKLAPEYRMVFLLSTFEGFSYKEIAEIT
151 GCPLGTVMSRLFRAREFMKNELSNYARSEGILRYRN

Name Aliases LCA Taxa Group Subgroup
ECFp106635
  • RNA polymerase sigma-70 factor, ECF subfamily
  • hypothetical protein
  • ... more
Sandaracinus amylolyticus ECF12 ECF12s5

>ECFp106635 ECF12 ECF12s5 Sandaracinus amylolyticus

1 MALSDDTPNPLRDEFAKEALVHLDSLYGAALRLTRSESDAEDLVQDAFLK
51 AYRFYDRFEPGTNLRAWLLRVLTNTFINKYRRNTRERRVLDGDEAEPVGD
101 GVMSRAAMRALTDPVGDAMRPLVVKEIQNALDELSDEHRLMIVLADVEEL
151 SYKEIADIVGCPIGTVMSRLHRARKQMQHRLVDTAVQMGIIDDKTEGTSE
201 PISLEAYRRTREVAG

>ECFp103444 ECF12 ECF12s5 Haliangium ochraceum DSM 14365

1 MVSRRKRRSEFEKLAIPHTDALFGAAFRMTRSQQGAEDLVQETMLRAYRF
51 WDTFQQDSNCKAWLFRILTNTFINSYQKNKRSREVLDAAHNEQRATDGIL
101 VHERALDLRNPEELLLSQTLSDDVVRALESLPADFRVAVVLCDVEGFSYK
151 EIAEILECPVGTVMSRLHRGRRLLQAALYDFAVEQGVIKPKPPAETPEAE
201 APEGSDAGTIDLSEYRKKKG

>ECFp31622 ECF12 ECF12s5 Anaeromyxobacter

1 MFDLRQNDLTRDEFQELALKHIDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRSVKERNIVEGSERDAVHER
101 FVSREAAEYAANPEQYFFDRLLSDDVLKAVDSLPIDFRMVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVVSGVIQLPESEDGES
201 IDLETYRRRRGKSA

Name Aliases LCA Taxa Group Subgroup
ECFp31307
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Anaeromyxobacter sp. Fw109-5 ECF12 ECF12s5

>ECFp31307 ECF12 ECF12s5 Anaeromyxobacter sp. Fw109-5

1 MFDLRQTDLTRGEFEELALKHLDPLYSAALRLTKNDRDAEDLVQDTFLRA
51 YRFFDKFERGTNMKAWLFKILTNTFINRYRRSVKERNIVEGSERDAVHER
101 FVSREAAEFAANPEQYFFDRLLSDDVLKAVDSLPIDFRLVVILADLQEFS
151 YKEIAEILDVPVGTVMSRLYRGRRLLQKALASYAVLSGVLQEVGEDGSID
201 LETYRKRRGKSA

>ECFp98524 ECF12 ECF12s5 Myxococcales bacterium SG8_38

1 MPKKERKIAATRRLFEGEVRPHLDALYSTALRLTRSPVDAEDLVQDTLVR
51 AYRFYDRFEAGTNFKAWLLRIQMNAFVNRYRRAARERQVFDGPMAAPVGE
101 GVMSRSTMRGLTDPVGDAQRQIIAREISRAFEELSDDARAMVLLADVEEL
151 SYKEIAEVIGCPIGTVMSRLHRARKQLQSSLRHHAVQLGIVDTDEDEVDD
201 PVSLEAFRSRKAVKP

>ECFp94431 ECF12 ECF12s5 Deltaproteobacteria bacterium RBG_16_71_12

1 MTLGSLFTRASTKDRAFEREAMPHMRSLYGAAMRLVRSPDDASDLVQETM
51 LKAYKAWDQFETGTNCKAWLFRIQTNAFINKYRRRVKEREILEGPERQAA
101 EHNLVHLPSKRAFLDPEGELVDRTLGDEVLKALDTVPEDFRTVVMLSDVE
151 GFSYKEIADLCEIPVGTVMSRLFRGRRILQEQLFA

>ECFp94224 ECF12 ECF12s5 Nitrospirae bacterium RBG_16_64_22

1 MTNPSASPSRSERFEAEALVHLGPLYRTALRLTGNDADAQDLVQETVLRA
51 FRFFDSFEPGTNCRAWLFRILMNTFVNEYRKRVRGPQQVDLDETTMGTLE
101 SRADQAIVSLPATPEEVVSAGMLDGDLKEGLRALPPEFRAAVLLCDVEEF
151 SYKEIAEMTQVPVGTVMSRIHRGRRALREFLLRRRRAKPVRALSAGA

>ECFp92587 ECF12 ECF12s5 Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10

1 MYLFRRRKDAQGRFEALVLPHLDALYGAAVRMTRHRQDAEDLVQETCLRA
51 YRFLDRLEDEGRCRAWLFRILTNTFINLYRREQRAPEMVALEESGVEAAA
101 SGEEVSLEAVMDDELKAALDALPDDYRTAILLSDVEEFSYEEIAGMLGCP
151 IGTVRSRIHRGRNLLRANLIRAAGRGGDLQGGSYA

>ECFp89834 ECF12 ECF12s5 Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10

1 MSLFRRRKDAPGRFEALVLPHLDALYGAAVRMTRHRQDAEDLVQETCLRA
51 YRFLDRLEDEGRCRAWLFRILTNTFINLYRRAQRAPETVALEEGETEVRA
101 SEGEVSLEAVMDDELKAALDALPDEYRVAVLMSDVEAFTYDEIAEILGCP
151 VGTVRSRIHRGRNLLRTHLLRAAGRRGGQQGGGYA

>ECFp87667 ECF12 ECF12s5 candidate division Zixibacteria bacterium RBG_16_48_11

1 MPEELLSSKPSEFEKAALVHLNSVFAVARRMTKNQTDAEDLVQETYLKAY
51 RFFHRFQPGTNCRAWLLRILTNIFINKYRQKAREPQSVEFQQAEEYRLNQ
101 QLLAPNRNPDPEESLWSQVGKEQIKKALETLPEEFRLAVVLCFVEGFSYD
151 EIAEILGVRLGTVKSRIHRGRLLLKTQLLNYAQQMGLLKE

>ECFp87574 ECF12 ECF12s5 candidate division KSB1 bacterium RBG_16_48_16

1 MVTDENVYSLECKKIFEELSLQYMDLLYSTALRMTKNTEEAEDLVQDSYL
51 RAYRFFHKFEQGTNFKAWIFRILTNTFINRYRKKLRTPKKVELDKVSFFI
101 EDEEAIRDLDINNGSDDPSYGELFDDDINRALNKLSDDFRQIILLADVEG
151 LSYKEIAKKANIPIGTVMSRLFRGRRMLQKKLFKYALKEGYVHSDSIEL

>ECFp87602 ECF12 ECF12s5 Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10

1 MTMGEGLHQVSPAFEAGALALVDSLYRAALRLTRVPTDAEDLVQETYLKA
51 FRAAGRFEPGTNLRAWLFTILHNTARNRARDRGRDTVDVDSEVVERAADT
101 RAFGAGRSGTPETPETLLLRDTMAPELQAAVDALPDAFRQAVWLRDVEEF
151 SYAEIAAMLAIPVGTVMSRISRGRRALYERLRSAQSVTGRPAPAGVIDD

>ECFp86963 ECF12 ECF12s5 Myxococcales bacterium SG8_38_1

1 MRPRPRKIATERRLFETEARPHLDTLYSTALRLTRSPVDAEDLVQDTLVR
51 AYRFYDRFEAGTNFKAWLLRIQMNAFVNRYRRSIRERQVFDGPMAAPVGE
101 GVMSRATMRGLTDPVGDAQRQIIAREINRAFEQLSEDARAMVLLADVEEL
151 SYKEIAEVMGCPIGTVMSRLHRARKQLQVSLQQHAVQLGIIEADEDSEED
201 PVSLEAFRSRKAVKS

>ECFp86975 ECF12 ECF12s5 Nitrospinae

1 MEDKKREDFKHTAVPYFNIIYNSAYRMTGNKADAEDLVQDVFLSAYKSFH
51 QFESGTNCRAWLFKILKNTFINKIKKAGREAKQVRELGGSAVREFNSSTP
101 VDKGLDETIQNALNRLPEEFRMAIVLCDVEGFSYQEISEIMECPVGTVRS
151 RISRGRQLLAEDLSAYSRQLLP

>ECFp86783 ECF12 ECF12s5 Gemmatimonas sp. SM23_52

1 MSEQAAHRRQEFEREALVHLDTLYNVAVRLCGNASDAEDLVQETVAKAYR
51 AWDKYERGTNCRAWLVTILRNTFINQYRRESKRPSPVEYESVEETSVFES
101 VQDRDPEGSFFRYIVDDEVKRAIQELPEEFRIPLVLSDVEGMSYAEIAEA
151 LELPVGTVKSRLFRGRRRLQQRLYEYALEMGYIR

>ECFp86679 ECF12 ECF12s5 Candidatus Fermentibacter daniensis

1 MQEGQGDRFEVEVLQYLDGLYGYAIHLTRNPEDASDLVQETYARAFKARS
51 QYRLGTNARAWLFAILRNTFLNDRRSACRSPRTVSCEWLDELAGEDQDGF
101 ESPRSPDPQKSFIAGLMREDIEKALNELPEEFRSAVVLCDVEEMSYSEIS
151 QILGIPIGTVRSRIHRGRAILRKLLVEWQSSMEGSGGEVLKGG

Name Aliases LCA Taxa Group Subgroup
ECFp86518
  • RNA polymerase sigma-70 factor, ECF subfamily
  • Cabys_12
Caldithrix abyssi DSM 13497 ECF12 ECF12s5

>ECFp86518 ECF12 ECF12s5 Caldithrix abyssi DSM 13497

1 MTRDRQKEFAELIEPHLSSLYNTALRMTHNQHDAEDLVQDTLFKAYRALD
51 QFQKDTNFRAWVFRILVNTFITAYRKTIRQPQKVSYDEMEEFFLYKRLDE
101 TVSMQEVPKEEFLENLFDDDVKEALDNLPYQFRLVVLLCDVEGFSYQEIS
151 EIIDAPLGTVMSRLYRGRKLLQRYLWNYAKERGYITDEFKPKK

Name Aliases LCA Taxa Group Subgroup
ECFp85857
  • RNA polymerase sigma-70 factor
  • hypothetical protein
  • ... more
Candidatus Brocadia sinica ECF12 ECF12s5

>ECFp85857 ECF12 ECF12s5 Candidatus Brocadia sinica

1 MREENNRRKEFEEIALTHIDSLYNMALRLVFNKEEAEDLVQETYLKAYRF
51 FDTFQTGTNIKAWLFKILRNTFINKYRKSASMPGEVFLEDIESVNTNMAY
101 DQEAKSEEAIDTLESKYTDLSSLLDDDVKRAIDSLPIEYREAILFSDVEE
151 LSYKDISEITNVPIGTVKSRLNRGRKLLQKSLWEYAKDRGFIKRGK

>ECFp84559 ECF12 ECF12s5 Acidobacteria bacterium RBG_13_68_16

1 MNGQTSWDFKNAELPFRDQLYKTAVRLTRSAEDAEDLLQETYLKAYRHYA
51 SFEPGTNLKAWLFKILKNTFINEYRRRKQLPAQVDFAEFEETFESALVAT
101 DARVTRSPEEELLEASLDAEVRTSLTALPHNYKVVVLLADIEGYAYKEIA
151 DILAIPVGTVMSRLYRGRRLLEKALLSFGVRYNYLHHRPHRLRSENLDVE
201 NLFGKGAAAPAHTRVH

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more