ECF proteins of ECF subgroup ECF12s4

Displaying ECF 61 - 70 of 70 in total

>ECFp99760 ECF12 ECF12s4 Hymenobacter sp. PAMC 26554

1 MSDSPERVKLSKEEKDRRFQAELMPVLDPLYNFAYRLTLDEDDANDLVQE
51 TYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEIE
101 GYYNPDEVEGDADTGASSSDMRQQSTRDLIGDEVASALNSLPVDFRTVII
151 LCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKEKLEKYASSMGYGND
201 DAQDAVDDAEHDDENT

>ECFp30489 ECF12 ECF12s4 Prosthecochloris sp. CIB 2401

1 MTSHNKEEQQISPEEAQKQRDFQEEAIQHINALYNYALHLTMNPDDAHDL
51 VQETYLKAYKFFDSFEKGTNCKAWLFKILKNNYINKFRKNAREPGKVDYD
101 QIKDFYHSIKDAQSDSEDLNAGYMKSLMHDEVYQALHGLPEEFREVIELC
151 DIEGFTYEEIANMVESPIGTVRSRLFRGRKLLREKLDAFARKYGYGTEE

>ECFp31764 ECF12 ECF12s4 Chlorobaculum limnaeum

1 MKEKKQMLTAQEQLKQQEFHQEAVAHINSLYNYALHLTMNPDDAEDLVQE
51 TYLKAYKFFDSFERGTNCKAWLFKILKNNYINKFRKNAREPGKVDYDLIK
101 DFYHTIKDVQSDTTEAESDFFHSLLHEEVYQALQSLPEEFREVIQLCDIE
151 GFTYEEIANMVESPIGTVRSRLYRGRKLLRAKLEDYAKKHGYDTEYGE

Name Aliases LCA Taxa Group Subgroup
ECFp30764
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Pontibacter ECF12 ECF12s4

>ECFp30764 ECF12 ECF12s4 Pontibacter

1 MSEQTGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNSDDVEGEGGVASTTDMRTESVQDLIGDEVASALNALPVDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKSMGYNS

Name Aliases LCA Taxa Group Subgroup
ECFp31759
  • RNA polymerase subunit sigma
  • ASU33_03555
  • ... more
Solirubrum puertoriconensis ECF12 ECF12s4

>ECFp31759 ECF12 ECF12s4 Solirubrum puertoriconensis

1 MSDTPERVPKLSKEEKDRRFQAELLPVLDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNTEEVDAEGDTGSTSPDLRQQATRDLIGDEVASALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLERYAKKMGYGN
201 DSEEADVAEAYDEDED

Name Aliases LCA Taxa Group Subgroup
ECFp31335
Chlorobium limicola ECF12 ECF12s4

>ECFp31335 ECF12 ECF12s4 Chlorobium limicola

1 MDTQKSSEKKKTKHGKEVLSKEELKKQQEFQAEAIAHINSLYNYALHLTM
51 NPDDAEDLVQETYLKAYKFFNSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHSIKDTRVDTTEADSDYFHSLMHEEVYQALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRGQLENYAKK
201 YGFNTDTEE

Name Aliases LCA Taxa Group Subgroup
ECFp30196
Balneola sp. EhC07 ECF12 ECF12s4

>ECFp30196 ECF12 ECF12s4 Balneola sp. EhC07

1 MRDNKKKQQEFNKEIIPHLDVMYNFALRLTTDPVDAEDLVQDTIVKAYRF
51 FSSYENGTNAKAWLFRILKNSFINNYRKTSKKPQQVDYDEVSSYYESVRA
101 ERTETSDLENLMFRELMDDEMSIALKQLPEDFRTVVLLCDVEGYTYEEIA
151 NMLDVPIGTIRSRLHRGRNLLKTELIDYAKKRGYRGD

Name Aliases LCA Taxa Group Subgroup
ECFp178737
Chlorobium sp. KB01 ECF12 ECF12s4

>ECFp178737 ECF12 ECF12s4 Chlorobium sp. KB01

1 MKKNEPVRQIKTKKGSLSREEQQKQLEFQIEAVVHLNSLYNYALHMTMNP
51 DDAEDLVQETYLKAYRFFNSFERGTNCKAWLFKILKNNYINRFRKNSREP
101 GKVDYDLIKDFYHSIKDTRSDTTEAESDYFHSLLHEEVYQALHSLPEEFR
151 EVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRVQLESYAKKYG
201 FNTNADQ

Name Aliases LCA Taxa Group Subgroup
ECFp30974
  • RNA polymerase sigma factor RpoE
  • Hsw_3629
  • ... more
Hymenobacter swuensis DY53 ECF12 ECF12s4

>ECFp30974 ECF12 ECF12s4 Hymenobacter swuensis DY53

1 MSDSPERVPKLSKEEKDRRFQAELMPVLDPLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEADSDAGTASTDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKEKLEKYAKSMGYGS
201 DADSNDDDDYTSSTDSE

>ECFp30468 ECF12 ECF12s4 Hymenobacter sp. AT01-02

1 MSDSPERVPKLSKEEKDRRFQAELMPVLDPLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEADGDAGSTSTDMRQQAVRDLIGDEVASALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGS
201 ENGDDDLALDENE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more