ECF proteins of ECF subgroup ECF12s4

Displaying ECF 41 - 60 of 70 in total
Name Aliases LCA Taxa Group Subgroup
ECFp31803
  • RNA polymerase sigma factor RpoE
  • B051_RS0103620
Pontibacter roseus DSM 17521 ECF12 ECF12s4

>ECFp31803 ECF12 ECF12s4 Pontibacter roseus DSM 17521

1 MSEQTGKQMSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNSDDVEGEGGVATTTDMRTESVQDLIGDEVASALNALPVDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKSMGYNG

Name Aliases LCA Taxa Group Subgroup
ECFp31869
  • RNA polymerase sigma factor RpoE
  • MROS_0448
  • ... more
Melioribacter roseus P3M-2 ECF12 ECF12s4

>ECFp31869 ECF12 ECF12s4 Melioribacter roseus P3M-2

1 MTKENNITTNKDVYKDFEREAIPHMNALYNFALRLTGDPDEADDLLQETY
51 LKAFRFFDKFEKGTNCKAWLYRIMKNSFINDYRKVTKEPAKVDYEDVQNF
101 YETIKAEEITFNHYQSDAFSNLLDDDITGAISNLPEDFRTVIILSDIEGF
151 SYEEIADFVDIPVGTVRSRLHRARKMLYSKLFDYAKSKGFLKKAGKKK

>ECFp31937 ECF12 ECF12s4 Candidatus Thermochlorobacteriaceae bacterium GBChlB

1 MTLAEPKSDSQRLTRAEIERQLDFQKEAMIHIDSLYNFALRMTGDAEDAN
51 DLVQETYMKAYRFFDSFEKGTNCKAWLFRILKNSYINKYRKESKEPDKVD
101 YDDIKEFYHTIKHSSLDSNDMQEKMFGELLDDEVARALESLPEDFKEVVQ
151 LCDIEGFTYEEIANMVDCPIGTVRSRLHRGRKILRDKLMEYAIQHGYRFN
201 PDDWQD

Name Aliases LCA Taxa Group Subgroup
ECFp673
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Pelodictyon luteolum DSM 273 ECF12 ECF12s4

>ECFp673 ECF12 ECF12s4 Pelodictyon luteolum DSM 273

1 MTRTEPTRQSSPEQKKTILTAEEQKKQSEFQTEAVVHLNALYNYALHLTM
51 NPDDANDLVQETYLKAYKFFSSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHTIKDTRRDSSETETDYFHALLHEEVYTALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLREQLEGYAKK
201 FGFNTETGR

Name Aliases LCA Taxa Group Subgroup
ECFp677
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Chlorobium phaeovibrioides DSM 265 ECF12 ECF12s4

>ECFp677 ECF12 ECF12s4 Chlorobium phaeovibrioides DSM 265

1 MSRPDPIRKSSPDTKKNPLSTEEQLKQREFQDEAIVHINALYNYALHLTL
51 NPHDANDLVQETYLKAYKFFGSFEKGTNCKAWLFKILKNNYINRYRKNAR
101 EPGKVDYDLIKDFYHTIKDTRRDSTETETDYFHSLLHEEVYMAMQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRVQLEEYAKK
201 FGFNTEKDR

>ECFp84273 ECF12 ECF12s4 Aphanocapsa montana BDHKU210001

1 MPKNAIFMVQTKEITTMSSSNSNVFEEEFLPQIDALYTFAYHLTYNEEDA
51 NDLVQETYLKAFRFIDSYNAGTNAKAWLFRILKNAFINQYRKKSKQPTQV
101 DYEEIINYHDEEESSLTSYHDLREEMFQGMMGDEVTNAINALPVDFRVVI
151 LLCDVEGFTYEEISKIVDIPIGTVRSRLHRARNMLKEQLKTYAASLGYKD
201 KRK

Name Aliases LCA Taxa Group Subgroup
ECFp85308
  • RNA polymerase sigma factor RpoE
  • GM79_RS20070
Hymenobacter sp. IS2118 ECF12 ECF12s4

>ECFp85308 ECF12 ECF12s4 Hymenobacter sp. IS2118

1 MSDSPERVKLSKEEKDRRFQAELMPVLDPLYNFAYRLTLDEDDANDLVQE
51 TYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEIE
101 GYYNPDDVEAEGELGASSSDMRQQSTRDLIGDEVASALNSLPVDFRTVII
151 LCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAQSMGYGND
201 TIDDETELTELENN

>ECFp91229 ECF12 ECF12s4 Nitrospinae bacterium RIFCSPLOWO2_12_39_16

1 MRKKEFEGLALPHIDSLYNFAIKLTRNEGDAEDLVQETYLRAYKFFDKYK
51 KNTHIKAWLFSILRNTFINIYRKKKKEPEKVDFHSVEQFIDKLTDRDNLL
101 SKDDISNDLTKETFDSEIKSALDELPEDFRSVILLSDIEGFSYQEISDVL
151 KCPVGTVMSRLHRGRKMLYKNLSEYAKKMGYL

Name Aliases LCA Taxa Group Subgroup
ECFp92104
  • RNA polymerase sigma factor RpoE
  • WX88_RS15310
Hymenobacter terrenus ECF12 ECF12s4

>ECFp92104 ECF12 ECF12s4 Hymenobacter terrenus

1 MSDSPERVKLSKEEKDRRFQAELMPVLDPLYNFAYRLTLDEDDANDLVQE
51 TYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEIE
101 GYYNPDDVEAEGEVGASSSDMRQQSARDLIGDEVASALNSLPVDFRTVII
151 LCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAQSMGYGND
201 AIDDETELTEPDND

Name Aliases LCA Taxa Group Subgroup
ECFp95268
  • hypothetical protein
  • rpoE_3
  • ... more
Cesiribacter andamanensis AMV16 ECF12 ECF12s4

>ECFp95268 ECF12 ECF12s4 Cesiribacter andamanensis AMV16

1 MIENEDWEPTGEEQPNADRTDKSARSSIRHQREQDESEQADTEGDEDALA
51 DDASEEAPLERYSETQKMRIFDKEFLPHIDAMYNFAYRLTFDEDDAKDLV
101 QETYLKAFRFINSFEEGTNAKAWLFRILKNSFINDYRKKSKEPAKVDYND
151 VESYYNSEDAQVEMTTDLRVESLRDMIGDEVSNALNSLAVDFRTVIILCD
201 LEGFTYEEMAKILDIPIGTVRSRLHRARNLLKDKLRSYAKSMGY

Name Aliases LCA Taxa Group Subgroup
ECFp95749
bacterium SM23_31 ECF12 ECF12s4

>ECFp95749 ECF12 ECF12s4 bacterium SM23_31

1 MWKNIDEKKEAFESEALVHMDTLYNGALKLTYNEEDAKDLVQETYFKAFR
51 FFDQFEPGTSCKAWLFKILKNTFINKYRKKAKQPEHVDYNTVEPFVEIIK
101 DKQYFDSDSLDDSILNNYLSDEINEALSKLSYEFRMILILSDIEGFSYKE
151 IADIMDCPIGTIRSRLSRARKLMFKLLSKYAKQEGYYREEDEE

Name Aliases LCA Taxa Group Subgroup
ECFp698
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-70 factor, ECF subfamily
  • ... more
Chlorobaculum tepidum TLS ECF12 ECF12s4

>ECFp698 ECF12 ECF12s4 Chlorobaculum tepidum TLS

1 MKENKQTLTAQEQLKQQEFQKEAVAHINSLYNYALHLTMNPDDAHDLVQE
51 TYLKAYRFFDSFERGTNCKAWLFKILKNNYINKFRKNAREPGKVDYDLIK
101 DFYHTIKDVQSDTTEAESDFFHSLLHEEVYQALQSLPEEFREVIQLCDIE
151 GFTYEEIANMVESPIGTVRSRLYRGRKLLRAKLEDYAKKHGYDTEIDQ

Name Aliases LCA Taxa Group Subgroup
ECFp704
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chlorobium limicola DSM 245 ECF12 ECF12s4

>ECFp704 ECF12 ECF12s4 Chlorobium limicola DSM 245

1 MDTQKSSEKKKTKHGKEVLSREELKKQQEFQAEAIAHINSLYNYALHLTM
51 NPNDAEDLVQETYLKAYKFFNSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHSIKDTRVDTTEADSDFFHSLMHEEVYQALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRGQLENYAKK
201 YGFNTDSEE

Name Aliases LCA Taxa Group Subgroup
ECFp684
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chlorobium phaeobacteroides BS1 ECF12 ECF12s4

>ECFp684 ECF12 ECF12s4 Chlorobium phaeobacteroides BS1

1 MSSSSDNKNAPEKKSILSEKDKIKQKEFQEEAIEHINALYNYALHLTMNP
51 SDAHDLVQETYLKAYKFFSSFEKGTNCKAWLFKILKNNYINKFRKNAREP
101 GKVDYDLIKDFYHSIKDSQSESEDLNAGYLRSLMHDEVYQAMNSLPEEFK
151 EVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKILRSKLTEFASKYG
201 YNTENEEPGEQ

Name Aliases LCA Taxa Group Subgroup
ECFp680
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Prosthecochloris aestuarii DSM 271 ECF12 ECF12s4

>ECFp680 ECF12 ECF12s4 Prosthecochloris aestuarii DSM 271

1 MINSSSSHKPPALLKKEHVSAQEQQKQIEFQQEAIQHINALYNYALHLTM
51 NPDDAKDLVQETYLKAYKFFGSFEKGTNCKAWLFKILKNNYINKFRKNSR
101 EPGKVDYDLIKDFYHSIKAAQSDNEDLNAGYFKSLMHDEVYQALQSLPDE
151 FKEVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRSKLNDFAKK
201 YGYHTEDNE

Name Aliases LCA Taxa Group Subgroup
ECFp695
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Pelodictyon phaeoclathratiforme BU-1 ECF12 ECF12s4

>ECFp695 ECF12 ECF12s4 Pelodictyon phaeoclathratiforme BU-1

1 MDKPDPARDLKTGTKKETLSRDERRKQLEFQNEAVVHLNALYNYALHLTM
51 NPSDAEDLVQETYLKAYRFFNSFERGTNCKAWLFKILKNNYINRFRKNSK
101 EPGKVDYDLIKDFYHSIKDTRSDTTESESDYFHSLLHEEVYQALHSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRSQLEGYAKK
201 YGFNTDNVQ

Name Aliases LCA Taxa Group Subgroup
ECFp30414
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chloroherpeton thalassium ATCC 35110 ECF12 ECF12s4

>ECFp30414 ECF12 ECF12s4 Chloroherpeton thalassium ATCC 35110

1 MLIVLTINTGKNNPPKHMIKSKQPENSSENLFAQDFSEQPSPNEDMEHLE
51 ENQDMDAFADDDMLSSVNASPKLTKGEILRQVDFQKEAMIHIDSLYNFAL
101 RMTGDPEDANDLVQETYMKAYRFFDSFEKGTNCKAWLFRILKNSYINRYR
151 KESKQPDKVDYDDIKEFYHTIRHSSSDSNDMQEKLFGNLMDEQVSRALNS
201 LPEDFREVVQLCDIEGFTYEEIANMVDCPIGTVRSRLHRGRKILRDKLID
251 YAKEHGYKVTSEDFDD

Name Aliases LCA Taxa Group Subgroup
ECFp30368
  • RNA polymerase sigma factor RpoE
  • PK28_15750
  • ... more
Hymenobacter sp. DG25B ECF12 ECF12s4

>ECFp30368 ECF12 ECF12s4 Hymenobacter sp. DG25B

1 MSDSPERVSKLSKEEKDRRFQAELMPVIDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEAEGDAGSTSSDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGT
201 DDEADDNDTTDSDADHD

>ECFp31910 ECF12 ECF12s4 Hymenobacter sp. DG25A

1 MSDSPERVSKLSKEEKDRRFQAELMPVIDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEAEGDVGSTSSDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGT
201 DDEADDNDTTDSDADHD

Name Aliases LCA Taxa Group Subgroup
ECFp31066
Rufibacter sp. DG15C ECF12 ECF12s4

>ECFp31066 ECF12 ECF12s4 Rufibacter sp. DG15C

1 MSEQRGNSMSKEEKDARFEAELMPVISSLYNFAFRLTLDEDDANDLVQET
51 YLKAYRFFDYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEVEG
101 YYNSEDVDTEGDSSGGTTDLRMESVQDLIGDEVASALNSLPVDFRTVIIL
151 CDLEGFTYEEMAKILDIPIGTVRSRLHRARHFLKEKLEKYAKSMGYNS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more