ECF proteins of ECF subgroup ECF12s4

Displaying ECF 21 - 40 of 70 in total

>ECFp178801 ECF12 ECF12s4 Ignavibacteria bacterium 13_1_40CM_2_61_4

1 MIFPIFPLSIESKTRSKHEEFQREAVPHMDVLYNYALRMTSNPDDANDLV
51 QETFMKAYRFWDKYEKGTNIRAWLFRIMKNSYINRYRKETKEPETVDYND
101 IQNFYNSIRYESTDPNDLQEKIFGGLLEDDVARALESLPEEFRTVVILCD
151 IEGLSYEEIAEFVDCPIGTVRSRLHRGRQMLRAKLYDYAKKRGYVTHD

>ECFp140427 ECF12 ECF12s4 Ignavibacteria bacterium CG1_02_37_35

1 MIKSSRFYDEFNKEAIPHRAALLNFAIRMTGNEDDANDLVQETYLRAFRF
51 FDKFEGGTNCKAWLFRILKNTFINAYRKEKKEPNKVDYEDIENFYENTKP
101 SNTDDSHLEREIFDNLLDDEVSEAIQTLPEDFRTVVILSDIEGFTYDEIA
151 DFINCPVGTVRSRLHRARKMLYSKLYTYADDKGYI

Name Aliases LCA Taxa Group Subgroup
ECFp29952
  • RNA polymerase sigma factor RpoE
  • PONAC_RS0119925
Pontibacter actiniarum DSM 19842 ECF12 ECF12s4

>ECFp29952 ECF12 ECF12s4 Pontibacter actiniarum DSM 19842

1 MSEQTGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNSEDVEGESGVASTTDMRTESVQDLIGDEVASALNALPVDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKGMGYNS

Name Aliases LCA Taxa Group Subgroup
ECFp30061
  • RNA polymerase sigma factor RpoE
  • H145_RS0100635
Hymenobacter aerophilus DSM 13606 ECF12 ECF12s4

>ECFp30061 ECF12 ECF12s4 Hymenobacter aerophilus DSM 13606

1 MSDSPERVPKLSKEEKDRRFQAELMPVLDPLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEEVEADSDAGTTSSDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKEKLDKYARSMGYGS
201 NGAAADDEDEDESSTD

Name Aliases LCA Taxa Group Subgroup
ECFp30161
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Chlorobium phaeobacteroides DSM 266 ECF12 ECF12s4

>ECFp30161 ECF12 ECF12s4 Chlorobium phaeobacteroides DSM 266

1 MNTLESSDKKTGKVKTAPLSREEQQKQLEFQQEAIAHINSLYNYALHLTM
51 NQDDAEDLVQETYLKAYKFFNSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHSIKDSRRDTTETDSDYFHSLLHEEVYQALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRGQLEEYAKK
201 YGFNTDNAD

>ECFp30176 ECF12 ECF12s4 Rhodohalobacter halophilus

1 MASLSKEEIRKQEDFNEEIIPHLDALYNFGLRLTSDPNDAEDLVQDTIVK
51 AYRFFDSYEKGTNAKAWLFRILKNSYINNYRKKSKKPQEVDYDEVASFYE
101 SIRAERTETSDMEDKMFRELIDDDISNALDEIPEDFRTVVLLCDVEDFTY
151 EEIANMLDVPIGTIRSRLHRGRNLLKAQLMDYATKKGYTQD

>ECFp30219 ECF12 ECF12s4 Ignavibacteria

1 MFPILSAVLESQNKLYKEFELEALPHLDALYNFALRMTGDGDDANDLVQD
51 TFLKAFRFFDKFEKGTNCKAWLFRIMKNTFINTYRKKSKEPDKVDYEDVE
101 NFYQNVKPSSTDSTHLEKEIYDNLFDDDISLALASLPDDFKTVIILSDIE
151 GFTYDEIADFIDCPVGTVRSRLHRARKMLFAKLYKYANEKGYV

>ECFp30220 ECF12 ECF12s4 Bacteroidetes bacterium HLUCCA01

1 MGDLTHEELKKQQDFRAEMIPHLDALYNFALRLTTDPTDAEDLVQDTIVK
51 AFRFFNSYEKGTNAKAWLFRILKNSYINNYRKKSKQPHQVDYDEVSTYYE
101 TVRSEQSDTTDMEDIMYREMLDDQVTRALERLPEDFRTVVLLCDVEGFTY
151 EEIANMLDVPIGTIRSRLHRGRNLLRTALVEYADKKGYNLD

>ECFp30288 ECF12 ECF12s4 Balneola vulgaris DSM 17893

1 MRDTKKKQQEFNEEIIPHMDVLYNFALRLTTDPNDAEDLVQDTIVKAFRF
51 FSSYEKGTNAKAWLFRILKNSFINNYRKVSKRPQEVDFDEVSTYYESVRA
101 ERTETSDLERLMFRELMDDELSIALSRLPEDFRTVVLLCDVEGYTYEEIA
151 NMLDVPIGTIRSRLHRGRNLLKTELLEYAKKRGYTGD

Name Aliases LCA Taxa Group Subgroup
ECFp30285
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Ignavibacterium album JCM 16511 ECF12 ECF12s4

>ECFp30285 ECF12 ECF12s4 Ignavibacterium album JCM 16511

1 MFFPFIFNFAIVVPDENQRQLYEDFEREAVPHMDALYNFALKMTGDSDEA
51 DDLVQETFLKAFRFFDKFEKGTNCKAWLFRIMKNTYINKYRKETKEPDKV
101 DYEEVENFYENVKPSSTDSAHLEKDIYDNLLDDELSEAINSLPEDFKTVV
151 ILCDIEGFTYEEIADFIDVPVGTVRSRLHRARKMLFTKLQKYAAERGYIS
201 KDEK

>ECFp30921 ECF12 ECF12s4 Gracilimonas tropica DSM 19535

1 MSQLTRDEIKKQKDFDEEIIPHMDALYNFALRLTSDPNDAEDLVQDTIVK
51 AYRFFSSYEKGTNAKAWMFRILKNSFINNYRKNSKKPSQVDYDEVSSYYE
101 SVRAERTETSDLENLMFREMMDDDLSEALTRLPEDFRTVVLLCDVEGYTY
151 EEIANMLDVPIGTIRSRLHRGRNLLKTELLEYAKKRGYTGD

>ECFp30832 ECF12 ECF12s4 Ignavibacteria bacterium RIFCSPHIGHO2_02_FULL_56_12

1 MLPILLALQSGSDRDKHQEFESEALPHMDLLYSFALRTTGNEDDARDLLQ
51 ETYLKAYRFWDKYEKGTNIRAWLFRIMKNSYINRYRKETREPDTVDYENV
101 ENFYDSIRDESRDSTDLQQRMFGGLLGDEVTSALQELPDDFRTVVILCDI
151 EGLTYEEIAEFLDCPIGTVRSRLHRGRKMLQKQLFSYARERGYIGKADGD
201 AGHTG

>ECFp30904 ECF12 ECF12s4 Ignavibacteria bacterium RIFCSPLOWO2_12_FULL_56_21

1 MLPILLALQSGSDRDKHQEFESEALPHMDLLYSFALRTTGNEDDARDLLQ
51 ETYLKAYRFWDKYEKGTNIRAWLFRIMKNSYINRYRKETREPDTVDYENV
101 ENFYDSIRDESRDSTDLQHRMFGGLLGDEVTSALQELPDDFRTVVILCDI
151 EGLTYEEIAEFLDCPIGTVRSRLHRGRKMLQKQLFEYARERGYIGKADGD
201 AGHTG

Name Aliases LCA Taxa Group Subgroup
ECFp30957
  • RNA polymerase sigma factor RpoE
  • K350_RS0109235
Sporocytophaga myxococcoides DSM 11118 ECF12 ECF12s4

>ECFp30957 ECF12 ECF12s4 Sporocytophaga myxococcoides DSM 11118

1 MEENRENIRKDLSKAEKDAQFEKEFMPLIDSLYNFAYRLTLDEDDANDLV
51 QETYLKAYRFFNSYEQGTNAKAWLFRILKNSFINDFRKKSKEPSKVDYQE
101 VESYYNSDDVDESITTDLRIESLQEMIGDEVATALNALAVDFRTIIILCD
151 LEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKTYAGTMGYNK

Name Aliases LCA Taxa Group Subgroup
ECFp30916
Pelodictyon luteolum ECF12 ECF12s4

>ECFp30916 ECF12 ECF12s4 Pelodictyon luteolum

1 MTRTDPTRQSSPEQKKNTLSAEEQKKQSEFQQEAVVHLNALYNYALHLTM
51 NPDDANDLVQETYLKAYKFFSSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHTIKDTRRDSSETETDYFHTLLHEEVYTALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLREQLEGYAKK
201 FGFNTETGR

Name Aliases LCA Taxa Group Subgroup
ECFp30960
  • RNA polymerase sigma factor RpoE
  • PKOR_08340
  • ... more
Pontibacter ECF12 ECF12s4

>ECFp30960 ECF12 ECF12s4 Pontibacter

1 MSDQTGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNTDDVEGESGVATTTDMRTESVQDLIGDEVASALNALPVDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKSMGYNS

>ECFp31038 ECF12 ECF12s4 Ignavibacteria bacterium RIFOXYA2_FULL_37_17

1 MRAITNTLSDKELQQRYAEFEKEAVPHLDAVYNFALRMTGDEDDADDLVQ
51 ETYLKAFRFFDKFEKGTNCKAWLFRILKNSFINDYRKTTKEPNKVDYDDV
101 QNFYENIKADEVETQHYEEDAFSNLLDDEISKAISELPEDFRTVVILSDI
151 EGFTYEEIADFVDIPVGTVRSRLHRARKMLYVQLFDYAKDKGFVKKKIPA
201 KKSD

>ECFp31061 ECF12 ECF12s4 Sporocytophaga myxococcoides

1 MEENRENIRKDLSKAEKDAQFEKEFMPLIDSLYNFAYRLTLDEDDANDLV
51 QETYLKAYRFFNSYEQGTNAKAWLFRILKNSFINDFRKKSKEPSKVDYQE
101 VESYYNSDDVDESITTDLRIESLQEMIGDEVATALNALAVDFRTIIILCD
151 LEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKAYAGTMGYNK

Name Aliases LCA Taxa Group Subgroup
ECFp31264
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chlorobaculum parvum NCIB 8327 ECF12 ECF12s4

>ECFp31264 ECF12 ECF12s4 Chlorobaculum parvum NCIB 8327

1 MKENKPVLSAKEQLKQKEFQEEAVTHINSLYNYALHLTMNPSDAQDLVQE
51 TYLKAYKFFDSFERGTNCKAWLFKILKNNYINKFRKNAREPGKVDYDLIK
101 DFYHTIKDVQRDTTETDSDFFHSLLHEEVYQALQSLPEEFREVIQLCDIE
151 GFTYEEIANMVESPIGTVRSRLYRGRKLLRAKLEDYARNHGYNTDSGE

>ECFp31642 ECF12 ECF12s4 Pontibacter akesuensis

1 MSEQQGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNTDDVEGEGGVATTTDMRTESVQDLIGDEVASALNALPIDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKSMGYNS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more