ECF proteins of ECF subgroup ECF12s4

Displaying ECF 1 - 20 of 70 in total

>ECFp30468 ECF12 ECF12s4 Hymenobacter sp. AT01-02

1 MSDSPERVPKLSKEEKDRRFQAELMPVLDPLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEADGDAGSTSTDMRQQAVRDLIGDEVASALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGS
201 ENGDDDLALDENE

Name Aliases LCA Taxa Group Subgroup
ECFp30974
  • RNA polymerase sigma factor RpoE
  • Hsw_3629
  • ... more
Hymenobacter swuensis DY53 ECF12 ECF12s4

>ECFp30974 ECF12 ECF12s4 Hymenobacter swuensis DY53

1 MSDSPERVPKLSKEEKDRRFQAELMPVLDPLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEADSDAGTASTDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKEKLEKYAKSMGYGS
201 DADSNDDDDYTSSTDSE

Name Aliases LCA Taxa Group Subgroup
ECFp178737
Chlorobium sp. KB01 ECF12 ECF12s4

>ECFp178737 ECF12 ECF12s4 Chlorobium sp. KB01

1 MKKNEPVRQIKTKKGSLSREEQQKQLEFQIEAVVHLNSLYNYALHMTMNP
51 DDAEDLVQETYLKAYRFFNSFERGTNCKAWLFKILKNNYINRFRKNSREP
101 GKVDYDLIKDFYHSIKDTRSDTTEAESDYFHSLLHEEVYQALHSLPEEFR
151 EVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRVQLESYAKKYG
201 FNTNADQ

Name Aliases LCA Taxa Group Subgroup
ECFp30196
Balneola sp. EhC07 ECF12 ECF12s4

>ECFp30196 ECF12 ECF12s4 Balneola sp. EhC07

1 MRDNKKKQQEFNKEIIPHLDVMYNFALRLTTDPVDAEDLVQDTIVKAYRF
51 FSSYENGTNAKAWLFRILKNSFINNYRKTSKKPQQVDYDEVSSYYESVRA
101 ERTETSDLENLMFRELMDDEMSIALKQLPEDFRTVVLLCDVEGYTYEEIA
151 NMLDVPIGTIRSRLHRGRNLLKTELIDYAKKRGYRGD

Name Aliases LCA Taxa Group Subgroup
ECFp31335
Chlorobium limicola ECF12 ECF12s4

>ECFp31335 ECF12 ECF12s4 Chlorobium limicola

1 MDTQKSSEKKKTKHGKEVLSKEELKKQQEFQAEAIAHINSLYNYALHLTM
51 NPDDAEDLVQETYLKAYKFFNSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHSIKDTRVDTTEADSDYFHSLMHEEVYQALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRGQLENYAKK
201 YGFNTDTEE

Name Aliases LCA Taxa Group Subgroup
ECFp31759
  • RNA polymerase subunit sigma
  • ASU33_03555
  • ... more
Solirubrum puertoriconensis ECF12 ECF12s4

>ECFp31759 ECF12 ECF12s4 Solirubrum puertoriconensis

1 MSDTPERVPKLSKEEKDRRFQAELLPVLDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNTEEVDAEGDTGSTSPDLRQQATRDLIGDEVASALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLERYAKKMGYGN
201 DSEEADVAEAYDEDED

Name Aliases LCA Taxa Group Subgroup
ECFp30764
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Pontibacter ECF12 ECF12s4

>ECFp30764 ECF12 ECF12s4 Pontibacter

1 MSEQTGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQET
51 YLKAYRFFDYFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEG
101 YYNSDDVEGEGGVASTTDMRTESVQDLIGDEVASALNALPVDFRTVIILC
151 DLEGFTYEEMAKILDIPIGTVRSRLHRARNSLKEKLEKYAKSMGYNS

Name Aliases LCA Taxa Group Subgroup
ECFp699
  • RNA polymerase sigma factor RpoE
  • Sigma-70 region 2:Sigma-70 region 4
  • ... more
Chlorobium ferrooxidans DSM 13031 ECF12 ECF12s4

>ECFp699 ECF12 ECF12s4 Chlorobium ferrooxidans DSM 13031

1 MKKNEPVRQIKTKKGSLSREEQQKQLEFQKEAVVHLNSLYNYALHMTMNP
51 DDAEDLVQETYLKAYRFFNSFERGTNCKAWLFKILKNNYINRFRKNSREP
101 GKVDYDLIKDFYHSIKDTRSDTTEAESDYFHSLLHEEVYQALHSLPEEFR
151 EVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRVQLESYAKKYG
201 FNTNADQ

>ECFp140410 ECF12 ECF12s4 Candidatus Kryptobacter tengchongensis

1 MKLKDKIKTLLKQEKRDKKLTDEELLKKQKEFEEEAIPHMQFLYNFAYRM
51 TGNEEDAKDLIQETYMKAFRFWDQYEPGTNIRAWLFKIMKNSYINKYRKA
101 TKEPGKVDYDEIQNFYETVRDESFETSDLQEHIFENIFEDEVIEALSKLP
151 DEFRTVVILADIEGQTYEEIAKFLDIPIGTVRSRLHRGRKMLRKELFEFA
201 KKKGYIKGKPEDYEIDDREKD

>ECFp31764 ECF12 ECF12s4 Chlorobaculum limnaeum

1 MKEKKQMLTAQEQLKQQEFHQEAVAHINSLYNYALHLTMNPDDAEDLVQE
51 TYLKAYKFFDSFERGTNCKAWLFKILKNNYINKFRKNAREPGKVDYDLIK
101 DFYHTIKDVQSDTTEAESDFFHSLLHEEVYQALQSLPEEFREVIQLCDIE
151 GFTYEEIANMVESPIGTVRSRLYRGRKLLRAKLEDYAKKHGYDTEYGE

>ECFp30489 ECF12 ECF12s4 Prosthecochloris sp. CIB 2401

1 MTSHNKEEQQISPEEAQKQRDFQEEAIQHINALYNYALHLTMNPDDAHDL
51 VQETYLKAYKFFDSFEKGTNCKAWLFKILKNNYINKFRKNAREPGKVDYD
101 QIKDFYHSIKDAQSDSEDLNAGYMKSLMHDEVYQALHGLPEEFREVIELC
151 DIEGFTYEEIANMVESPIGTVRSRLFRGRKLLREKLDAFARKYGYGTEE

>ECFp99760 ECF12 ECF12s4 Hymenobacter sp. PAMC 26554

1 MSDSPERVKLSKEEKDRRFQAELMPVLDPLYNFAYRLTLDEDDANDLVQE
51 TYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEIE
101 GYYNPDEVEGDADTGASSSDMRQQSTRDLIGDEVASALNSLPVDFRTVII
151 LCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKEKLEKYASSMGYGND
201 DAQDAVDDAEHDDENT

Name Aliases LCA Taxa Group Subgroup
ECFp31066
Rufibacter sp. DG15C ECF12 ECF12s4

>ECFp31066 ECF12 ECF12s4 Rufibacter sp. DG15C

1 MSEQRGNSMSKEEKDARFEAELMPVISSLYNFAFRLTLDEDDANDLVQET
51 YLKAYRFFDYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEVEG
101 YYNSEDVDTEGDSSGGTTDLRMESVQDLIGDEVASALNSLPVDFRTVIIL
151 CDLEGFTYEEMAKILDIPIGTVRSRLHRARHFLKEKLEKYAKSMGYNS

>ECFp31910 ECF12 ECF12s4 Hymenobacter sp. DG25A

1 MSDSPERVSKLSKEEKDRRFQAELMPVIDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEAEGDVGSTSSDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGT
201 DDEADDNDTTDSDADHD

Name Aliases LCA Taxa Group Subgroup
ECFp30368
  • RNA polymerase sigma factor RpoE
  • PK28_15750
  • ... more
Hymenobacter sp. DG25B ECF12 ECF12s4

>ECFp30368 ECF12 ECF12s4 Hymenobacter sp. DG25B

1 MSDSPERVSKLSKEEKDRRFQAELMPVIDSLYNFAYRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVEAEGDAGSTSSDMRQQAVRDLIGDEVARALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAKSMGYGT
201 DDEADDNDTTDSDADHD

Name Aliases LCA Taxa Group Subgroup
ECFp30414
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chloroherpeton thalassium ATCC 35110 ECF12 ECF12s4

>ECFp30414 ECF12 ECF12s4 Chloroherpeton thalassium ATCC 35110

1 MLIVLTINTGKNNPPKHMIKSKQPENSSENLFAQDFSEQPSPNEDMEHLE
51 ENQDMDAFADDDMLSSVNASPKLTKGEILRQVDFQKEAMIHIDSLYNFAL
101 RMTGDPEDANDLVQETYMKAYRFFDSFEKGTNCKAWLFRILKNSYINRYR
151 KESKQPDKVDYDDIKEFYHTIRHSSSDSNDMQEKLFGNLMDEQVSRALNS
201 LPEDFREVVQLCDIEGFTYEEIANMVDCPIGTVRSRLHRGRKILRDKLID
251 YAKEHGYKVTSEDFDD

Name Aliases LCA Taxa Group Subgroup
ECFp695
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Pelodictyon phaeoclathratiforme BU-1 ECF12 ECF12s4

>ECFp695 ECF12 ECF12s4 Pelodictyon phaeoclathratiforme BU-1

1 MDKPDPARDLKTGTKKETLSRDERRKQLEFQNEAVVHLNALYNYALHLTM
51 NPSDAEDLVQETYLKAYRFFNSFERGTNCKAWLFKILKNNYINRFRKNSK
101 EPGKVDYDLIKDFYHSIKDTRSDTTESESDYFHSLLHEEVYQALHSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRSQLEGYAKK
201 YGFNTDNVQ

Name Aliases LCA Taxa Group Subgroup
ECFp680
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Prosthecochloris aestuarii DSM 271 ECF12 ECF12s4

>ECFp680 ECF12 ECF12s4 Prosthecochloris aestuarii DSM 271

1 MINSSSSHKPPALLKKEHVSAQEQQKQIEFQQEAIQHINALYNYALHLTM
51 NPDDAKDLVQETYLKAYKFFGSFEKGTNCKAWLFKILKNNYINKFRKNSR
101 EPGKVDYDLIKDFYHSIKAAQSDNEDLNAGYFKSLMHDEVYQALQSLPDE
151 FKEVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRSKLNDFAKK
201 YGYHTEDNE

Name Aliases LCA Taxa Group Subgroup
ECFp684
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chlorobium phaeobacteroides BS1 ECF12 ECF12s4

>ECFp684 ECF12 ECF12s4 Chlorobium phaeobacteroides BS1

1 MSSSSDNKNAPEKKSILSEKDKIKQKEFQEEAIEHINALYNYALHLTMNP
51 SDAHDLVQETYLKAYKFFSSFEKGTNCKAWLFKILKNNYINKFRKNAREP
101 GKVDYDLIKDFYHSIKDSQSESEDLNAGYLRSLMHDEVYQAMNSLPEEFK
151 EVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKILRSKLTEFASKYG
201 YNTENEEPGEQ

Name Aliases LCA Taxa Group Subgroup
ECFp704
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Chlorobium limicola DSM 245 ECF12 ECF12s4

>ECFp704 ECF12 ECF12s4 Chlorobium limicola DSM 245

1 MDTQKSSEKKKTKHGKEVLSREELKKQQEFQAEAIAHINSLYNYALHLTM
51 NPNDAEDLVQETYLKAYKFFNSFERGTNCKAWLFKILKNNYINRFRKNSR
101 EPGKVDYDLIKDFYHSIKDTRVDTTEADSDFFHSLMHEEVYQALQSLPEE
151 FREVIQLCDIEGFTYEEIANMVESPIGTVRSRLYRGRKLLRGQLENYAKK
201 YGFNTDSEE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more