ECF proteins of ECF subgroup ECF12s2

Displaying ECF 161 - 180 of 322 in total

>ECFp30065 ECF12 ECF12s2 actinobacterium acMicro-1

1 MLAECPARPVPGPETDSRLGWGDMNESSEAKNALFVEQAMPYLDQLYGHA
51 MRKTSNPADANDLVQETYMKAFAAFDSYEQGTNLKAWLHRILENTFITNY
101 RKKAREPFQAPLEEFEDWQLGSAESRTATSSRSAEAEAIDHMPAGVVKDA
151 LHALPEEFRIAVFLADVEGFSYQEIADIMSTPSGTVMSRLHRGRRLLRES
201 LADYAHELGLNTTTPSGSKASAS

>ECFp30059 ECF12 ECF12s2 Actinomyces

1 MSQDDRDRLFAEQAIPLIDQLFGAALGMTRNRADAEDLVQETFMKAYTKF
51 HQYQQGTNIKAWLYRILTNTYITHYRKAQRSPKRSGGEEVEDWQLAAAAS
101 HDEKGLVSAEAEALDNIPSSQLRTALESLSEDQRVVVLLSDVEGFAYKEI
151 ADMLDIPIGTVMSRLHRGRKNLREGLSALAAEYGIGENHAD

>ECFp30073 ECF12 ECF12s2 Corynebacterium

1 MRTELSDAPALKTDRAEQPAAATAQPSGDFEELALPLLDQLYGGALKMTR
51 NPQDAEDLVQETYLKGFQNFAKFTPGTNLKAWLYRIMTNTYINGYRKKQR
101 QPVHTSADELTDGQLYTSSGHDPTGLVSAEVEALAMMPDTTIAAALNDLS
151 EDYRRVVYYSDVVGLAYKEIAEVLEIPLGTVMSRLNRGRKKLRETLKEVA
201 AEHGIAAAQEAVENSAGDKPAVSKASGPQTADAAKNAANSKEGER

>ECFp30120 ECF12 ECF12s2 Actinobacteria bacterium RBG_16_67_15

1 MADRADFTDQVMEYAPQLYAAALRMTRNPADAEDVLQETLLKAYRGYHTF
51 IPDTNLKAWLYRILTNTFINKYRRQSRRPHEVELGELEDLYLYKRLGEEG
101 TSGATRSAEDEALDRFVDADIKAALESLPENFRIPVLLADVEGFSYKEIA
151 EIMDVPIGTVMSRLHRGRKALQQALWRFAEDREATGP

Name Aliases LCA Taxa Group Subgroup
ECFp30142
  • RNA polymerase sigma factor RpoE
  • CSTAT_09950
Corynebacterium stationis ECF12 ECF12s2

>ECFp30142 ECF12 ECF12s2 Corynebacterium stationis

1 MAANTTRRTPVADSFEEQALPLLDQLYGGALRMTRNPQDAEDLVQETYLK
51 AFNAFDSYKQGTNLKAWLYRIMTNTYINSYRKAKRRPTESSADELTDFQL
101 YTTSGHDSTGLESAEVAALKSMPNQTVSEAMNDLPEDYRMVVYYADVVGL
151 AYKEIADVMETPLGTVMSRLHRGRKLLRKALKDVAREQGIGIGHPDMEDN

Name Aliases LCA Taxa Group Subgroup
ECFp30162
  • sigH
  • RNA polymerase sigma factor RpoE
  • ... more
Corynebacterium variabile ECF12 ECF12s2

>ECFp30162 ECF12 ECF12s2 Corynebacterium variabile

1 MTNTVKRTSDSDEQLLARFESDALPLLDQLYGAALGMTRNPTDAQDLVQD
51 AYMKAYQAFGSYKPGTNLKAWMYRILTNTYINQYRKKQRRPKETSDEAVT
101 DWQLADVASHDSTGLRSAEIEALQRIPDSRIRDALMELSDDYRMVVYYAD
151 VEDLPYKEIAEIMGTPIGTVMSRLHRGRKQLRTKLKDVAAERGIGLDATA
201 AAKTAKSSAKSSATAAKTKA

>ECFp30156 ECF12 ECF12s2 Streptomyces sp. NRRL S-118

1 MTDTLTPAAGGLLAPAETDEQRTARFEGDALGYRDQMYAAALRLHRNRAD
51 AEDLVQETFAKAYQSFHQFRAGTNLRAWLHRILINTFITLYRKRQHEPQW
101 ALVGEADDWIQVRAAGHGAARLPSAESQVLDRMADDEVLEALQALPAEFR
151 TVVYLADVEGLAYREIAARLGVPHGTVTSRLHRGRRRLRAQLTDYARTRR
201 LTAAEPGTGATPRKDR

>ECFp30195 ECF12 ECF12s2 Actinomyces odontolyticus F0309

1 MDTTTPSPTPQAPELTPASSALDGAELEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYQPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSAQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSVLADV
201 AAEYGIGATK

Name Aliases LCA Taxa Group Subgroup
ECFp30202
  • RNA polymerase subunit sigma
  • O146_RS11335
Corynebacterium ECF12 ECF12s2

>ECFp30202 ECF12 ECF12s2 Corynebacterium

1 MPLLDQLYGGALKMTRNPQDAEDLVQETYLKGFQNFAKFTPGTNLKAWLY
51 RIMTNTYINGYRKKQRQPVHTSADELTDGQLYTSSGHDPTGLVSAEVEAL
101 AMMPDTTIAAALNDLSEDYRRVVYYSDVVGLAYKEIAEVLEIPLGTVMSR
151 LNRGRKKLRETLKEVAAEHGIAAAQEAVENSAGDKPAVSKASGPQTADAA
201 KNAANSKEGER

Name Aliases LCA Taxa Group Subgroup
ECFp30205
Rothia ECF12 ECF12s2

>ECFp30205 ECF12 ECF12s2 Rothia

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAEAKAAAKASAKGQPAKATKGTKTAKGVKSPPAGSGSEAPADS

Name Aliases LCA Taxa Group Subgroup
ECFp30225
  • RNA polymerase ECF-subfamily sigma factor
  • sigR
  • ... more
Ilumatobacter coccineus YM16-304 ECF12 ECF12s2

>ECFp30225 ECF12 ECF12s2 Ilumatobacter coccineus YM16-304

1 MADQADFADQAMQYAPQLFSAAMRMTRNKADAEDLVQEAYLKGFRSFHTF
51 QEGTNLRAWLFRILTNTYINKYRAKQRRFDETDLGDVEDLYLYKRMGTFE
101 DPTIGRSAEESLMEMLPDDEVKRALEDLPENFRMPVILADVEGFAYKEIA
151 EMLDIPIGTVMSRLHRGRKAMQKALYDYAVENGIARSAIAASAEGNDTTD
201 SNAAVAATEK

Name Aliases LCA Taxa Group Subgroup
ECFp30246
  • RNA polymerase subunit sigma
  • H641_RS02050
Cutibacterium granulosum DSM 20700 ECF12 ECF12s2

>ECFp30246 ECF12 ECF12s2 Cutibacterium granulosum DSM 20700

1 MSEPAGAVDVAVAKETDEERAARFERDALGYLDQLYGAALRMTRNRADAE
51 DVVQEAFIKAFSSFHQFKPGTNLKAWLFRILTNTYINGYRKAQRRPQTAD
101 GDDVEDWQIARAASHDATGLRSAEVEALDTMPDERIREALDSLSDDFRQV
151 VMLADVEGFAYKEIAEIMGTPIGTVMSRLNRARKQLRAQLTEVAGARGIG
201 PMAGQISDETYEPLTMMQERA

>ECFp30256 ECF12 ECF12s2 Mycolicibacterium fortuitum

1 MSADVHVSIDDCLAERFERDALPLVDQLYAAARRYTHNAADAEDLVQDVM
51 AKAYGSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELTDA
101 QLAEVAQRFPLGVVSAELAALEAMGDDEVRQAVRALPESQGIVVYYADVA
151 GFRYKEIADILQIPVGTVMSRLHRGRRALRSRLIEMAVARGYLERPSHNG
201 TAA

Name Aliases LCA Taxa Group Subgroup
ECFp30255
  • hypothetical protein
  • T493_RS0109225
Propionibacteriaceae bacterium P6A17 ECF12 ECF12s2

>ECFp30255 ECF12 ECF12s2 Propionibacteriaceae bacterium P6A17

1 MDTSTLADDGLDPLATVDDRIDPFEEESLALVDRLYAAALGMTRNAADAE
51 DLVQETYAKAFSARESFTMGTNLKAWLYRILTNSFISHYRKAQRSPQLSD
101 DEEITDHQLASAASHDSRGLRSAEMEALDRLPDSVVSEALQALPEQYRLA
151 VWLADVEGFAYKEIAEIMDTPIGTVMSRINRGRGQLRKSLAEYAAERGFG
201 PRGQHRG

>ECFp30260 ECF12 ECF12s2 Mycobacterium sp. E802

1 LDQLYGAARRYTRNAADAEDLVQETMLKAYSGFHTFKPGSNARAWLFRIM
51 YNNWINSYRARQRAVGEQLCEDITDWQVSAEGRHTSSGLRSAEVEALEAM
101 RDDDIADALDAIPAANRMTVYFADVEGYHYREIAALMGTPVGTVMSRLAR
151 GRKRLRELLADVARDRGIGRDAGKVQAAVPLS

Name Aliases LCA Taxa Group Subgroup
ECFp30289
  • RNA polymerase sigma factor RpoE
  • TIGR02947 family RNA polymerase sigma-70 factor
  • ... more
Corynebacterium otitidis ECF12 ECF12s2

>ECFp30289 ECF12 ECF12s2 Corynebacterium otitidis

1 MTDDETLERRFEREALPLLDQLYGGALKMTRNPADAEDLVQETYMKAFQA
51 FDRFTEGTNLKAWLYRIMTNSYINTYRKRKRQPTQSPSEDITDYQLYTTA
101 SHDSSGLRSAEVEALDNLPDNEIVDALKQLREDYRMVVYYADVEGLAYKE
151 IAEVLDVPIGTVMSRLHRGRKQLRALLKDVARERGIDVSKAEQDEKKKSS
201 KGRKR

>ECFp30275 ECF12 ECF12s2 Mycolicibacterium aurum

1 MTEDAIRERFERDALPVLDQLYRAARRYTGNAADAEDLVQETMAKAYGAF
51 HRFEDGTNIRAWLLRILTNTWIKSYRRAQCRPAEVLSDGITDAQLAASAG
101 HSSTGMQSAELAALQALGDDEVRDALEQLREDQRLVVYYADVEGLRYKDI
151 ALILGIPEGTVMSRLHRGRRALRALLVDVAADRGYLRATSAA

Name Aliases LCA Taxa Group Subgroup
ECFp30279
Rothia mucilaginosa ECF12 ECF12s2

>ECFp30279 ECF12 ECF12s2 Rothia mucilaginosa

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAAAKASAKAQPAKATKAKSVKSPPAGSHSKAPADS

>ECFp30291 ECF12 ECF12s2 Actinomyces sp. oral taxon 172 str. F0311

1 MDTTTPQPAAQAPEPAPASSTPASSTPDDAALQARFMDEAMPLMNQLFGA
51 ALGMTRNRADAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITS
101 YRKAQRSPKRASTDTIEDWQLADAASHAEVGLKSAEVEALESLPSTQLRE
151 ALDSLSEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRS
201 ALADVAAEYGIGGTK

>ECFp30315 ECF12 ECF12s2 Rothia

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKA
201 EAKAEAKAAAKASTKGQPAKATKGTKAAKGVKSPPAGSGSEAPADS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more