ECF proteins of ECF subgroup ECF12s2

Displaying ECF 141 - 160 of 322 in total

>ECFp29904 ECF12 ECF12s2 Mycobacteriaceae

1 MRKDPHLERFERDALPLLDTLYRAARRYTANTADAEDLVQETMLKAYKAF
51 HHYQDGTNIRAWLLRILTNTWITSHRRAQSRPAELLSDSVTDSQLAAQAA
101 HSATGLPSAELAALTALGDDEVRYALGQLGEDQRIAVYYADVEGLPQREI
151 AEILDIPLGTVMSRVYRGRNALRRLLVNVAADRGYLRAA

>ECFp29917 ECF12 ECF12s2 Corynebacterium

1 MAKETISEKELQRRFEAEALPLLDQLYGGALRMTRNPQDAEDLVQETYLK
51 AYKSFHSFKQGTNLKAWLYRIMTNNYINSYRKAKRRPTESSADDLSDFQL
101 YTTAGHDSTGLESAEVAALKDMPNATISEAMNDLPDDYRMVVYYADVEGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKLLRKALKDVAREQGIGLEHPDMEEK

>ECFp29926 ECF12 ECF12s2 Corynebacterium falsenii

1 MAPTTTKRTNDGDAELLARFEEDALPLLDQLYGAALRMTRNPSDAQDLVQ
51 DAYMKAYHAFGSFKPGTNLKAWMYRILTNTYINNYRKAQRRPVESPTEGV
101 TDWQLAETASHDSTGLESAEVEALKKIPDRRIQQALMDLREDYRMVVYYA
151 DVEGLAYKEIAEIMDTPIGTVMSRLHRGRKLLRQALKDVAAEHGIGQGSA
201 NDAEQTGHESRKQV

Name Aliases LCA Taxa Group Subgroup
ECFp29967
  • RNA polymerase sigma factor RpoE
  • A606_08655
  • ... more
Corynebacterium terpenotabidum Y-11 ECF12 ECF12s2

>ECFp29967 ECF12 ECF12s2 Corynebacterium terpenotabidum Y-11

1 MTETVKRTEDSDEQLLARFESDALPLLDQLYGAALGMTRNPADAQDLVQD
51 TYMKAYQAFDSYRPGTNLKAWMYRILTNTYINQYRKAQRRPKETSDETVT
101 DWQLADVASHDSTGLRSAEIEALQRIPDSRIRDALMELSDDYRMVVYYAD
151 VEDLPYKEIAEIMGTPIGTVMSRLHRGRKQLRTKLKDVAAEQGIGLTPAG
201 TVQDSGTQKKSAAAATKA

>ECFp29950 ECF12 ECF12s2 Actinomyces georgiae

1 MDTTTRTPAGATPPAEQAELRERFMDEAMPLMDQLFGAALGMTRNRADAE
51 DLVQEAYLKAYSKFHQYKPGTNIKAWLYRILTNTYITQYRKAQRSPKRAS
101 TDTVEDWQLAEAASHDARGLVSAEVEALESLPSEQLRDALESLSEEHRMV
151 ILMADVESMTYKEIAQALGIPIGTVMSRLNRARRNLRAKLGEVAAEYGIG
201 GAR

>ECFp29960 ECF12 ECF12s2 Mycobacteriaceae

1 MSIDDCLAERFERDALPLVDQLYAAARRYTHNAADAEDLVQDVMAKAYGS
51 FHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELTDAQLAEVA
101 QRFPLGVVSAELAALEAMGDDEVRQAVRALPESQGIVVYYADVAGFRYKE
151 IADILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYLERPSHNGTAA

Name Aliases LCA Taxa Group Subgroup
ECFp30008
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Thermobaculum terrenum ATCC BAA-798 ECF12 ECF12s2

>ECFp30008 ECF12 ECF12s2 Thermobaculum terrenum ATCC BAA-798

1 MGQYTDTQLQTEDLFFEEALSYIDSLYRTALRLTNNPADAEDLVQETYLK
51 AHRFRDSFKPGTNLRAWLFRILTNTFINDYRKKSRQPQTTEMGELGEMED
101 YYLFRRVKEAGESLGEDPEQTVLNMFVDEEVREALDSLPEQYRLPVLLAD
151 VEGFSYKEIADVLGIPVGTVMSRLHRGRKQLQQKLWEYARQRGYKVEPPE
201 AQNE

Name Aliases LCA Taxa Group Subgroup
ECFp29997
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Leucobacter komagatae ECF12 ECF12s2

>ECFp29997 ECF12 ECF12s2 Leucobacter komagatae

1 MKSKEQGETPSNLKSRFADEALPLLDQLFGAAMKMTRNQQDAQDLVQETF
51 LKAYQAFASFEEGTNLKAWLYRIMTNSYINTYRKRQRQPFLGAVEELEDW
101 QLGGAESTTAMASRSAEAEAIDRTPDSVVTRALNELAEDFRMAVYLADVE
151 GFSYQEIADIQEVPIGTVMSRLHRGRAKLRQALGEYAREQGVGLERTDTT
201 QSEPAKGAAR

>ECFp29974 ECF12 ECF12s2 Actinobacteria bacterium RBG_16_68_21

1 MADQATFESDVMPFAPQLYSAALRMTRNPTDAEDVLQEALLKAFRGYHTY
51 ESGTNLKAWLYRILTNTFINKYRERSRRPSEVELGELEDLYLFKRLGGEE
101 STGGATRSAEEEALEGFVDEDIKGALESLPENFRMPVLLADVEGFSYKEI
151 AEIMDVPIGTVMSRLHRGRKALQRALWRLAEERGIPA

Name Aliases LCA Taxa Group Subgroup
ECFp29995
  • RNA polymerase sigma factor RpoE
  • A3E3_RS0106140
Corynebacterium capitovis DSM 44611 ECF12 ECF12s2

>ECFp29995 ECF12 ECF12s2 Corynebacterium capitovis DSM 44611

1 MADTDLRERFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKAFNAF
51 GSYKQGTNLKAWLYRIMTNTYINTYRKKQRRPVETSAEGVTDYQLYTSSS
101 HDSTGLESAEVEALKNLPNSRISDALNALNEDYRMVVYYADVEGLAYKEI
151 AEVMDIPLGTVMSRLHRGRKQLREMLKDVANEQGIGVDRADSKES

>ECFp30004 ECF12 ECF12s2 Mycolicibacterium wolinskyi

1 MPTIVEATEIVDDDRHDRFVRDALPLLDQLYGAARRYTRNQIDAEDLVQE
51 TMVKAYASFHTYRDGTNIRAWLFRILTNTWINAYRTAQRRPDEVFAEAIT
101 DAQLAAVARRSSVELASAELAALEVMGDDEVRRAVQLLPDFQRIVVYYAD
151 IAGFQYKEIAQILGVPVGTVMSRLHRGRRNLRESLAGTAVARGYVGPPET
201 GSSAA

Name Aliases LCA Taxa Group Subgroup
ECFp30002
  • RNA polymerase sigma24 factor
  • ON45_RS17025
Ilumatobacter nonamiensis YM16-303 ECF12 ECF12s2

>ECFp30002 ECF12 ECF12s2 Ilumatobacter nonamiensis YM16-303

1 MADQAVFADQAMQYAPQLFAAAMRMTRNRADAEDLVQEAYLKGFRSFHTF
51 TEGTNLRAWLFRILTNTYINKYRKKQRSFDESDLGDIEDLYLYKRMGTFE
101 DASIGRSAEESLMAMLPDDEVKQALEDLPENFRLPVILADVEGFAYKEIA
151 EMLDIPIGTVMSRLHRGRKAMQKALHDYAVARGLQREDAPQ

Name Aliases LCA Taxa Group Subgroup
ECFp30003
  • RNA polymerase subunit sigma
  • CUREI_RS02425
Corynebacterium ureicelerivorans ECF12 ECF12s2

>ECFp30003 ECF12 ECF12s2 Corynebacterium ureicelerivorans

1 MPETEPDNGASDDLKTRFNDEAMPLLDQLYGGALRMTRNPQDAEDLVQET
51 YLKAYKNFGSFTPGTNLKAWLYRIMTNTYINSYRKKQRRPLETSADEVTD
101 NQLYTSSSHDSTGLESAEVEALKAMPNSRISDALNSLNEDYRMVVYYADV
151 EGMAYKEIAEVMDIPIGTVMSRLHRGRKQLRGMLKDVAQERGIGLDHADM
201 AGATRAHSTAQDAKEK

Name Aliases LCA Taxa Group Subgroup
ECFp30011
Rothia mucilaginosa ECF12 ECF12s2

>ECFp30011 ECF12 ECF12s2 Rothia mucilaginosa

1 MAGTNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEVEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAEAKAAAKASAKVQPAKATKGTKATKGVKSPPAGSGSKAPADS

>ECFp30069 ECF12 ECF12s2 Actinobacteria bacterium RBG_19FT_COMBO_70_19

1 MLPNLYSAGLRLTRNPSDAEDLVQETYLRAYRGFARFEEGTNLRAWMYRI
51 LTNTFINSYRKKQREPVTVQDDEIEDWYLFDRLGASGVEASAESEVLDRL
101 PDEEVQRALEALPEGFRMAVLLADVEGFSYKEVAAILGVPIGTVMSRLHR
151 GRKALQKALWETVQERGLVAG

>ECFp30042 ECF12 ECF12s2 Actinomadura formosensis NBRC 14204

1 MTNIESTRRYERDVLPLADPLYASAVRMTRNTADAEDLVQETLAKAYVNF
51 HQFQEGTNLKAWLHRILTNNFINTYRKKQREPQRAGSEELEEWQLAQTEA
101 YASGFRSAESEALDRIPDSRVTAALHALPKDFRDTVYLADVEGYPYKEIA
151 ELMGTPIGTVMSRLHRGRKQLRESLAGHRAAHTLAA

Name Aliases LCA Taxa Group Subgroup
ECFp30030
Actinomyces sp. S4-C9 ECF12 ECF12s2

>ECFp30030 ECF12 ECF12s2 Actinomyces sp. S4-C9

1 MVMDKKEQVDEAELRARFEEEALPLLDQLYGAAFRMTGNEADAQDLVQDT
51 YVRAFSSFNTFKPGTNLKAWMYRILKNSFINTYRKNQRRPQQTSDEGVQD
101 WQLVEASSHHPVALESAEAAALDSLPDDTVREALESLSDTYREAVLLADV
151 EGFSYKEIAQIMGTPVGTVMSRIYRGRAQLRTALADYAKRMGIGVKEDHA

Name Aliases LCA Taxa Group Subgroup
ECFp30024
  • RNA polymerase
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Arcanobacterium haemolyticum DSM 20595 ECF12 ECF12s2

>ECFp30024 ECF12 ECF12s2 Arcanobacterium haemolyticum DSM 20595

1 MEIDQRPAHEPEQLSQQFEELALPLLDQLYGAALRLTRNPQDAEDLVQET
51 YAKAFAAFHQFTPGTNVKAWLYRILNNAFISNYRKAQRRPKEAESDQVED
101 WQEYSAASHDSRGLVSAEAEALENLPDSEIKDALDQLSDDRRTVVYLADV
151 EGFSYQEIADIVGVPIGTVMSRLHRGRTQLREILRDYALQLGYKVKQKAG
201 E

>ECFp30023 ECF12 ECF12s2 Corynebacterium argentoratense

1 MGQTPFEQQALPLLDQLYGGALRLTRNPADAEDLVQETYIKAFQAFDGFT
51 QGTNLKAWMYRIMTNLYITNYRKAQRRPTQTSAEEITDYQLLSSASHESQ
101 GLESAEVEALKKLPTSEISEALNALSEDYRMVVYYADVEGLAYKEIAEIM
151 GVPLGTVMSRLHRGRKKLRDALKDVARERGIGIAASEKRTQTAGTVGEEN

Name Aliases LCA Taxa Group Subgroup
ECFp30057
  • ECF sigma factor RpoE1
  • MSMEG_3485
  • ... more
Mycolicibacterium smegmatis ECF12 ECF12s2

>ECFp30057 ECF12 ECF12s2 Mycolicibacterium smegmatis

1 MTCHAATAPDGGPGADLSARFARDVVPMVDRLYGAALRLTANPQDAEDLV
51 QETILRAYTGFHTFREGSNLTAWLYRILHNTWINLYRKRQRRPNEVPMEG
101 VTDGEVLRFRHALRSAEVDALEALPDTEIKEALADLREQYRIVVYYADVE
151 GLSYKQIAEITGTALGTVMSRLHRGRRQLRASLRQVAEQRGLVSETVQ

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more