ECF proteins of ECF subgroup ECF12s2

Displaying ECF 121 - 140 of 322 in total

>ECFp178802 ECF12 ECF12s2 Corynebacterium sp. HMSC29G08

1 MPETELATDLNARFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKA
51 YNAFDSFKPGTNLKAWLYRIMANTYINNYRKMKRRPLETSAEDVTDSQLY
101 TSSSHDSTGLESAEVEALKMMPNSRISDALNSLNEDYRMVVYYADIEGLA
151 YKEIAEVMEIPLGTVMSRLHRGRKQLREMLKDVAHEQGIGLEDK

>ECFp178799 ECF12 ECF12s2 Corynebacterium

1 MATETTSETLQKQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQETYL
51 KAYSNFDSFKQRTNLKAWLYRIMTNTYINSYRKAKRRPLESSADELSDFQ
101 LYTTAGHDSTGLESAEVEALKQMPDSEISEAMNDLPEDYRMVVYYADVVG
151 LAYKEIADVMGTPLGTVMSRLHRGRKLLRAALKDVAREKGIGRNHPEMEE
201 K

>ECFp178899 ECF12 ECF12s2 Corynebacterium sp. NML120713

1 MPETDLKTRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETFLKAYNAF
51 DSFKPGTNLKAWMYRIMTNTYINTYRKKQRRPLETSAEDVTDHQLYTTSS
101 HDSTGLESAEVEALKAIPNSRISEALNALNEDYRMVVYYADVEGMAYKEI
151 AEVMDIPLGTVMSRLHRGRKQLREMLKDVAHEQGIGLDHADMAELTQQKA
201 EEK

>ECFp178825 ECF12 ECF12s2 Ferrithrix thermotolerans DSM 19514

1 MADQATFTEQALQYADALYAAALRMTRNAADAEDLLQETYLKAYRAFGSF
51 TEGTNLKAWLYRILTNTYINIYRAKKRRPEESDIEDVEDLYMYHRLSGLE
101 AASAGRSAEEEVLDQFSDLEVKSAIEELPEQFRLAVLLSDVEGFSYKEIA
151 DILGIPLGTVMSRLHRGRRALQKSLVELGMRKALVSDQG

>ECFp178831 ECF12 ECF12s2 Corynebacterium

1 MPEQDLKNRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKAYKAF
51 DRFTPGTNLKAWLYRIMTNTYINTYRKKQRRPLVTSADEVTDNQLYTSSS
101 HDSTGLESAEVEALKQMPNSRISEALNSLNEDYRMVVYYADVEGLAYKEI
151 AEVMDIPLGTVMSRLHRGRKQLREMLKDVAHDQGIGLERAATDAKNAEEK

Name Aliases LCA Taxa Group Subgroup
ECFp178819
Chlamydia trachomatis ECF12 ECF12s2

>ECFp178819 ECF12 ECF12s2 Chlamydia trachomatis

1 MVEELIRADTSESDEQRAARFERDALPYLDQLYGAAMRLTRNEQDAEDLT
51 QETYMKAFAAFHQYKPETNLKAWLYRILNNAFISNYRKAQRRPKEADSPD
101 VEDWQEYKAASHHSTGMPSAETQALDNLPDSEIREALEALPEDRRTAVYL
151 ADVEGFSYQEIAEIMQTPIGTVMSRLYRGRAQLREALHDYARNLGYAVKE
201 NV

>ECFp178842 ECF12 ECF12s2 Actinomyces sp. HMSC065F12

1 MANGSALKESAPVGKKERFEAEALPLLDQLYGAALSMTRHRADAEDLVQE
51 TFEKAYAKFDQYKPGTNIKAWLYRILTNTYITHYRKAKRSPKRSGTETVE
101 DWQLVDAASHSEEGLRSAEAEALDRIPSDQVRDAMEDLSEDYRVVVWLAD
151 VEQLSYKEIAQTLDIPIGTVMSRLHRGRAALRKSLAGLAREYGIGDNA

Name Aliases LCA Taxa Group Subgroup
ECFp178840
Agrococcus carbonis ECF12 ECF12s2

>ECFp178840 ECF12 ECF12s2 Agrococcus carbonis

1 MPVATATIDARAATLDSAAMTSDEAQADETGAARRDDFAEQAMQYADQLY
51 AAAMRMTRNPADAADLVQETLLKAYAAYGSFKPGTNLRAWLYRIQTNTYI
101 NTYRKQQRRPYEAALDDMEEWQIGDAESVSSTTTRSAEAEAIHRMPSGIV
151 KDALQQVPVDFRMAVYWVDVEGLSYAETAEVMETPVGTVMSRLHRGRKLL
201 RGLLADYAREQGIDVPESTTKEKKP

>ECFp178848 ECF12 ECF12s2 Candidatus Rhodoluna planktonica

1 MKKSENSVAADKLRSFELQALPLMPQLYGAALRWTRNPSDAEDLVQETFA
51 KAYIAWAQFEQGTNLKAWLYRIMTNTHINLYNKRAKDQAKGALDELEDWQ
101 LGSAESVTSTSSRSAELEAIDNLPSKAVKDALNQIPDEFRMVVYYAVVDG
151 LPYAEIAQIMNTPVGTVMSRLHRGKKLLKKLLAEYAAQEGYNVTNSGTAN
201 D

>ECFp178879 ECF12 ECF12s2 Actinomyces

1 MVMDKKEQVDEAELRARFEEEALPLLDQLYGAAFRMTGNEADAQDLVQDT
51 YVRAFSSFNTFKPGTNLKAWMYRILKNSFINTYRKNQRRPQQTSDEGVQD
101 WQLVDASSHHPVALESAEAAALDSLPDDTVREALESLSDTYREAVLLADV
151 EGFSYKEIAQIMGTPVGTVMSRIYRGRAQLRTALADYAKRMGIGVKEDHA

>ECFp178866 ECF12 ECF12s2 Corynebacterium sp. HMSC078H07

1 MATDTTSASETSEKQREQQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDL
51 IQETYLKAYSNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPTESSAD
101 ELSDFQLYTTAGHDSTGLESAEVEALKQMPDSEISDAMNDLPEDYRMVVY
151 YADVVGLAYKEIAEVMDTPLGTVMSRLHRGRKLLRTALKDVAREKGIGRD
201 HPDMNSKTEEK

>ECFp178886 ECF12 ECF12s2 Mycobacterium sp. SWH-M5

1 MPVTADTRLTDNDSRVENFERDALPLLDQLYGVARRYTRNPADAEDLVQE
51 TMLKAYSSFHTYRDGTNIRAWLFKILTNTWINSYHTAQRRPNVVLTDTIS
101 DAQLAAVAARSETELASAELAALEAMGDSEVRDAVAALPEPQRMAVYYAD
151 VVGLRYQEIADVLDVPVGTVMSRLHRGRKRLRDHLVEFAYATGYLVRPAG
201 TAA

Name Aliases LCA Taxa Group Subgroup
ECFp178896
Chlamydia trachomatis ECF12 ECF12s2

>ECFp178896 ECF12 ECF12s2 Chlamydia trachomatis

1 MTTFDNASRPFAEVELDQTFVRDAIPYEKVLFRAALRLTGNRTDAEDLVQ
51 ETYLRAYAKFHQYAQGTNLKAWLYRILTNTFISEYRKAQRRPKHSPNEDV
101 EDWQLMQAASHDSVGLESAETEALARIPSTQIQEALHSLSDEQRAVVVLA
151 DVESLSYKEIADILDIPIGTVMSRLSRGRASLRRTLADLAKEYGITGDNN
201 E

>ECFp178889 ECF12 ECF12s2 Brachybacterium sp. P6-10-X1

1 MSHLDSLYGGALRMTRNPHDAEDLVQETFMKAFRARGRFTPGTNMRAWLY
51 RIMTNAFITTYRKKQRRPKEAWTDTVEDWQLAEVGSHTSSGLRSAETEAL
101 DHLPDSAVKDALGELREDYRMAVYLADVEGFAYKEIAEIMDTPIGTVMSR
151 LHRGRRQLREMLSDYAYRSGFLRADPAATAAEGSDAADDAPHETRSTDRE
201 EER

Name Aliases LCA Taxa Group Subgroup
ECFp178884
Nonomuraea maritima ECF12 ECF12s2

>ECFp178884 ECF12 ECF12s2 Nonomuraea maritima

1 MTDEQRKDWFERDVVPVTSQLFASAMRLTRNAADAEDLVQETVAKAYTSY
51 HQFREGTNLKAWLHRILTNNFINDYRKKQRSPKLSAAEDIEDWQLHAAES
101 HTSTGLRSAETEALDRLPDSVVMNALRSLPEDFRVAVYLADVEGFAYKEI
151 AERMGTPIGTVMSRLHRGRRQLRGMLEEYAREEGAVRLSTESAAA

Name Aliases LCA Taxa Group Subgroup
ECFp178891
Rothia sp. HMSC066G02 ECF12 ECF12s2

>ECFp178891 ECF12 ECF12s2 Rothia sp. HMSC066G02

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPMGTVMSRLHRGRRILREKLLDYARENGLRPSTIAEV
201 EAKAEAKAAAKAGAKAQPAKATKAKGVKSPPASSRSEAPADS

>ECFp181751 ECF12 ECF12s2 Mycolicibacterium conceptionense

1 MEQIRGRARRLTTNPYDAEDLLQDTMLKAFSGFHTFQPDSNARAWLFRIL
51 TNTWINSYRTAQRRPQEVFADELTDAQLAEVAERFPLGVVSAELAALESM
101 GDDDVRQAMRALPESQGIVVYYADVAGFRYKEIAEILQIPVGTVMSRLHR
151 GRRNLRTLLVGAEVAGGYVGNRMPCAAA

Name Aliases LCA Taxa Group Subgroup
ECFp29894
  • RNA polymerase sigma factor RpoE
  • CDOO_03720
  • ... more
Corynebacterium doosanense CAU 212 = DSM 45436 ECF12 ECF12s2

>ECFp29894 ECF12 ECF12s2 Corynebacterium doosanense CAU 212 = DSM 45436

1 MTAMTDTAQRLEARFEEEALPLLDQLYGGALRMTRNPQDAEDLLQETYLK
51 AFKAFGSFKEGTNLKAWLYRIMTNTYINTYRKKQRQPAQTPTEEITDYQL
101 YTTSSHDSTGLRSAEVEALQNMPNGRISEAMNQLSDDYRMVVYYADIEGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKQLRELLKDVARDQGIGLSHPDMVAD
201 VKKES

>ECFp29902 ECF12 ECF12s2 Mycolicibacterium vulneris

1 MPISTGAHMSVDDCLSERFERDALPLVDQLFAAARRYTRNMADAEDLVQE
51 TMVKAYSSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVLADELT
101 DGQLAEVAQRSPLGVVSAELAALEAMGDDEVRQAMRSLPESQGIIVYYAD
151 VEGFRYKEIAEILRIPVGTVMSRLHRGRRNLRARLVEADVATEYVGNRLP
201 CTAA

Name Aliases LCA Taxa Group Subgroup
ECFp29907
  • RNA polymerase subunit sigma
  • ADJ76_05090
  • ... more
Actinomyces ECF12 ECF12s2

>ECFp29907 ECF12 ECF12s2 Actinomyces

1 MDTTTPLPTPADTSPAPASSTEEDAQLQARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITGYRKAQ
101 RSPKRASTDTVEDWQLAAAASHAESGLKSAEVEALEALPSTQLRDALNSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRVSLADV
201 AAEYGIGGAK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more