ECF proteins of ECF subgroup ECF12s2

Displaying ECF 61 - 80 of 322 in total
Name Aliases LCA Taxa Group Subgroup
ECFp30675
  • RNA polymerase subunit sigma
  • CKROP_RS07380
Corynebacterium kroppenstedtii DSM 44385 ECF12 ECF12s2

>ECFp30675 ECF12 ECF12s2 Corynebacterium kroppenstedtii DSM 44385

1 MHVVRRFSVANQADFEEQAMPLLDQLYAGALRMTRNPPDAEDLVQETYMK
51 AYRNFGSFKEGTNLKAWMYRIMTNAYINDYRKAQRRPTESPTDEITDWQL
101 AANAEHDSTGLESTEVEALKNIPDERIRDALMDLPEDNRMVVYYADVEGM
151 PYKEIAHVMGTPVGTVMSRLHRGRKKLREALKEVASERGIGGVQPAGSSE
201 GSS

>ECFp30664 ECF12 ECF12s2 Actinomycetaceae

1 MTQTTKRAPAESVAERRQRFEQDALPHLDELYRGALRFTRNPADAEDLVQ
51 DAMVKAYAAFDQYKPGTNLRAWLFRILRNTYINKYRKEQRRPPTADAGEL
101 QDWQLAKAASHDSVGLLSAEVEALAALPEGTVREALMELPEDYRIAVFLA
151 DVEGFSYKEIAQIMDTPTGTVMSRLHRGRSRLRKALANYVAEGEES

>ECFp30704 ECF12 ECF12s2 Mycobacterium sp. URHD0025

1 MAGAGAEPMSTDMHVSVDDRAERFERDALPLVDQLYAAARRYTRNAADAE
51 DLVQETMVKAYSSFHTYRDGSNIRAWLYRILTNTWINTYRTAQRRPQEVF
101 ADELSDVQLAEVAQRFPLGVVSAELAALESMGDDDVREAMRALPESQGVV
151 VYYADVAGFRYKEIADILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYL
201 ESPSRNGTAA

>ECFp30691 ECF12 ECF12s2 Corynebacterium

1 MATQEKSPSFEEQAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKAYNSF
51 DSYTRGTNLKAWMYRIMTNTYINSYRKAKRRPHESSADELTDSQLYTTSG
101 HDSSGLESAEVEALRGMPDGAISDAMNDLPEDYRMVVYYADVVGLAYKEI
151 AEVMGTPLGTVMSRLHRGRKLLRGALKDVAREQGIGLHHPDMEDK

Name Aliases LCA Taxa Group Subgroup
ECFp30723
  • RNA polymerase sigma factor RpoE
  • G554_RS0105365
Acidipropionibacterium thoenii DSM 20276 ECF12 ECF12s2

>ECFp30723 ECF12 ECF12s2 Acidipropionibacterium thoenii DSM 20276

1 MTLPDTPAQAETLPDLAEETDEQRVERFERDAMGYLDQLYGAALRMTRNP
51 ADAEDVVQESYAKAFSSFKQFKPGTNLKAWLFRILTNTYINTYRKAQRRP
101 QTSDDENVEDWQIARAASHQATGLRSAEVEALDAMPDTQVLDALEGLSDD
151 FRQVVLLADVEGFSYKEIAQIMGTPIGTVMSRLNRARKQLRAQLVDVAGA
201 RGIGPLAGKVDEETLGQEVHS

>ECFp163035 ECF12 ECF12s2 Ferrithrix thermotolerans DSM 19514

1 MQYADALYAAALRMTRNAADAEDLLQETYLKAYRAFGSFTEGTNLKAWLY
51 RILTNTYINIYRAKKRRPEESDIEDVEDLYMYHRLSGLEAASAGRSAEEE
101 VLDQFSDLEVKSAIEELPEQFRLAVLLSDVEGFSYKEIADILGIPLGTVM
151 SRLHRGRRALQKSLVELGMRKALVSDQG

>ECFp163105 ECF12 ECF12s2 Mycobacterium sp. GA-1841

1 FHTFSEGTNIRAWLFKILTNTWINSYRTAQRRPEEVLTESVTDAQLAAAL
51 AGSPIELASAELAALEAMGDDEVRHAMEALPDFQRVIVYYADVACFRYKE
101 IAELMDIPVGTVMSRLHRARRNLRKRLAEAAVARGYLGSGQDDGTAA

>ECFp166915 ECF12 ECF12s2 Mycobacterium sp. NS-7484

1 FEDLVQETMLKAFSSFHTFADGTNIRAWLFKILTNTWINSYRTTQRRPEE
51 VLAESVTDAQLAAALAGSPIELASAELAALESMGDDEVRRAMEALPDFQR
101 VIVYYADVEGYHYREIAALMGTPVGTVMSRLARGRKRLRELLADVARDRG
151 IGRDAGKVQAAVPLS

>ECFp178465 ECF12 ECF12s2 Leucobacter chromiiresistens

1 MSDTAAQAKLEQRFTSEALPMLDQLYGAAMKMTRNPQDAQDLVQETFLKA
51 FSAFASFQEGTNLKAWLYRIMTNSYINTYRKRQREPHMGAVDELEDWQLG
101 GAESTTAMSSRSAEAEAIDRTPDSVVTTALNALPEDFRIAVYLADVEGFS
151 YQEIADIAEVPIGTVMSRLHRGRARLRKALGEYANEQGVGLNAGAKQTKK
201 GAAR

>ECFp178469 ECF12 ECF12s2 Corynebacterium appendicis CIP 107643

1 MAPMAGNDLEQRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKAF
51 KAFDSFKEGTNLKAWLYRIMTNTYINSYRKKQRRPLETSAEDVTDRQLYT
101 TSSHDSTGLQSAEVEALKNLPDTQIAEAMNSLNDDYRMVVYYADVEGLAY
151 KEIAEVMDVPLGTVMSRLHRGRKQLRELLKDVANEQGIGLEEQK

>ECFp178488 ECF12 ECF12s2 Mycobacterium sp. GA-1841

1 MNDDGRVERFERDALPLLDQLYGAARRYTRNAADAEDLVQETLLKAYSGF
51 HTFHPGSNARAWLFRIMYNNWINSYRARQRAVSEHLCEDFADWQLSAEGR
101 HTSTGLRSAEVEALEAMRDDDIADALDAIPAANRMTVYFADVEGYHYREI
151 ASLMGTPVGTVMSRLARGRKRLRELLADVARDRGIGRDTSTDQAAVPSS

>ECFp178481 ECF12 ECF12s2 Corynebacterium sp. NML130628

1 MAPMPETDLKTRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETFLKAY
51 NAFDSFKPGTNLKAWMYRIMTNTYINSYRKKKRRPLETSAEDVTDHQLYT
101 TSSHDSTGLESAEVEALKAMPNSRISEALNALNEDYRMVVYYADVEGMAY
151 KEIAEVMDIPLGTVMSRLHRGRKQLREMLKDVAHEQGIGLDHADMADLKQ
201 QKVEEK

>ECFp178508 ECF12 ECF12s2 Corynebacterium mycetoides

1 MADTDLQRRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQDTFLKAYNAF
51 DSYKPGTNIKAWLYRIMTNSYINTYRKKQRRPLETSTDDMTDHQLYTTSS
101 HDPTGLESAEVEALKGMPNGRISEAFDELNEDYRMVVYMADVDGMAYKEI
151 AEALDIPLGTVMSRLHRGRKQLRSMLKDVANEQGIGLEEKK

>ECFp178515 ECF12 ECF12s2 Mycobacterium sp. SWH-M5

1 MNCHAATAPEPGPGTDLSARFEREVVPLVDRLYGVALRLAANPQDAEDLV
51 QETVLRAYTGFHTFREGSNLMAWLYRILHNTWINLYRKRQRRPAEVSMEG
101 VTDHEVLRFRHALRSAEVAALEALPDNEIKDALMELREQYRIVVYYADVE
151 GLSYKQIAQITDTALGTVMSRLHRGRRQLRASLRHVAEQRGLVAEDVH

>ECFp178516 ECF12 ECF12s2 Actinomyces bouchesdurhonensis

1 MDTTTPQPMPDAPDSAPASSAPASPAPDDAALQAHFMDEAMPLMDQLFGA
51 ALGMTRNRTDAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITS
101 YRKAQRSPKRASTDTVEDWQLADAASHAEVGLKSAEVEALEALPSTQLRE
151 ALDSLSEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKKLRS
201 TLADVAAEYGIGGDK

>ECFp178512 ECF12 ECF12s2 Corynebacterium sp. HMSC068H04

1 MATETTSETLQKQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQETYL
51 KAYSNFDSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPVESSADELSDFQ
101 LYTTAGHDSTGLESAEVEALKQMPDSEISEAMNDLPEDYRMVVYYADVVG
151 LAYKEIADVMGTPLGTVMSRLHRGRKLLRAALKDVAREKGIGRNHPEMEE
201 K

Name Aliases LCA Taxa Group Subgroup
ECFp178528
Rothia sp. HMSC076D04 ECF12 ECF12s2

>ECFp178528 ECF12 ECF12s2 Rothia sp. HMSC076D04

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKVAAKASVKGQPAKATKGTKATKGVKSPPAGSGSKAPADS

Name Aliases LCA Taxa Group Subgroup
ECFp178546
Actinomyces urinae ECF12 ECF12s2

>ECFp178546 ECF12 ECF12s2 Actinomyces urinae

1 MVMDKKEQVDEAELRARFEEEALPLLDQLYGAAFRMTGNEADAQDLVQDA
51 YVRAFSSFNTFKPGTNLKAWMYRILKNSFINTYRKNQRRPQQTSDEGVQD
101 WQLLEAANHHPVALESAEAAALDSLPDDTVREALESLSDTYREAVLLADV
151 EGFSYKEIAQIMGTPVGTVMSRIYRGRAQLRTALADYAKQMGIGVK

>ECFp178561 ECF12 ECF12s2 Agrococcus sp. Marseille-P2731

1 MTSEQGQASEQAQSSRRDDFVEQAMQYADQLYAAAMRMTRNPADAADLVQ
51 ETLLKAYAAYGSFKQGTNLRAWLYRIQTNTYINLYRKQQRRPFEAPLDDM
101 EEWQIGDAESFTATSSRSAEAEAIHRMPSGIVKDALQQVPVDFRMAVYWV
151 DVEGLSYAETAEVMETPVGTVMSRLHRGRKLLRGLLADYAREQGIAVPDT
201 AASGTAGQGTKKEKKP

>ECFp178574 ECF12 ECF12s2 Actinomyces sp. HMSC035G02

1 MDTTTPSPTPQAPEPAPASSAPDGAAPEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALESLPSSQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGAK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more