ECF proteins of ECF subgroup ECF12s2

Displaying ECF 41 - 60 of 322 in total
Name Aliases LCA Taxa Group Subgroup
ECFp140215
Actinomyces ihuae ECF12 ECF12s2

>ECFp140215 ECF12 ECF12s2 Actinomyces ihuae

1 MANGSALKESAPAGKKERFEAEALPLLDQLYGAALSMTRHRADAEDLVQE
51 TFEKAYAKFDQYKPGTNIKAWLYRILTNTYITHYRKAKRSPKRSGTETVE
101 DWQLVDAASHSEEGLRSAEAEALDRIPSDQVRDAMEDLSEDYRVVVWLAD
151 VEQLSYKEIAQTLDIPIGTVMSRLHRGRAALRKSLAGLAREYGIGDNA

>ECFp140207 ECF12 ECF12s2 Mycobacterium

1 MPMSTDTHMSVDGCLSERFERDALPLVDQLFAAARRYTRNVPDAEDLVQE
51 TMVKAYSSFHTYRDGTNIRAWLFRIMTNTWINSYRTAQRRPQEVFADELT
101 DGQLAEVAQRFPLGVVSAELAALESMGDDDVRQAMRALPESQGIVVYYAD
151 VEGFRYKEIAEILQIPVGTVMSRLHRGRRNLRARLVDADVAGGYVSNRLP
201 CTAA

Name Aliases LCA Taxa Group Subgroup
ECFp140218
  • RNA polymerase sigma factor RpoE
  • D474_RS0121570
Nocardiopsis salina YIM 90010 ECF12 ECF12s2

>ECFp140218 ECF12 ECF12s2 Nocardiopsis salina YIM 90010

1 MDQTPKTGEARDERAEHQQEQTLDFATAVTPFADQLYPTALRMTRNPADA
51 EDLVQETFAKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQE
101 TTDEIKDWQLAAAEAHTSSGMRSAETEVLDHLPDSDIKQALARLPLDFQE
151 VIYLVDIEGYAYKEVAERMDTPLGTVMSRLHRARRQLREMLADYGRERGM
201 RVPEQ

Name Aliases LCA Taxa Group Subgroup
ECFp140259
  • RNA polymerase sigma factor RpoE
  • D475_RS0126015
Nocardiopsis gilva YIM 90087 ECF12 ECF12s2

>ECFp140259 ECF12 ECF12s2 Nocardiopsis gilva YIM 90087

1 MATIELERTAATEQAPETPEELDFVTAVTPYADQLYPTALRMTRNAADAE
51 DLVQETFTKAFANFHQFKAGTNLRAWLYRILTNTFINGYRKKQREPRQDS
101 TDEIKDWQLAAADAHTSSGARSAEMEVLDHLPDSDIRVALAELPEEFRLV
151 VYLIDIEGYSYKEVAARMGTPLGTVMSRLHRARRQLREMLTDYARERGVR
201 AAA

>ECFp140281 ECF12 ECF12s2 Corynebacterium cystitidis DSM 20524

1 MADMSQTDLSERFTDEAMPLLDQLYGGALRMTRNPQDAEDLVQETYLKAF
51 NAFESFKPGTNLKAWMYRIMTNTYINSYRKMKRRPLETSADEMTDRQLYT
101 TSSHDSTGLQSAEVEALQNMPNSQITDALNSLSDDYRMVVYLADVEGFAY
151 KEIAEIMNIPVGTVMSRLHRGRKQLRGLLKDVAAEKGIGLGHPDMQDGQQ
201 EGTE

Name Aliases LCA Taxa Group Subgroup
ECFp140296
  • hypothetical protein
  • BN1186_RS13435
Tessaracoccus massiliensis ECF12 ECF12s2

>ECFp140296 ECF12 ECF12s2 Tessaracoccus massiliensis

1 MLEASPDAELDDAAAAAFEEEALGYLDQLYGAALRMTRNPSDAEDVVQDT
51 YARAFASRHTFKPGTNLKAWLYRILTNSYINTYRKAQRSPQTSGDEEVTD
101 WQLARAANHDSTGLRSAEMEALDQTPDAAVADAIAALPENYRMAVLLADV
151 EGFSYKEIAEIMDTPIGTVMSRLNRGRAQLRESLAEYAKQRGIGRKAGGR

Name Aliases LCA Taxa Group Subgroup
ECFp140329
  • RNA polymerase sigma factor RpoE
  • N420_RS0116530
Mycolicibacterium iranicum UM_TJL ECF12 ECF12s2

>ECFp140329 ECF12 ECF12s2 Mycolicibacterium iranicum UM_TJL

1 MTMTMTDPDLERFERDALPLLDTLYRAARRYTGNAADAEDLVQETMMKAY
51 AAFHRFEEGTNIRAWLLRILTNTWIKSYRRSQCRPAEILSEGLTDAQLHD
101 HAGHSSTGLPSAELAALESLGDDEVRQALEQLSEEQRLVVYYADVEGLSY
151 KEIALILGTPVGTVMSRLHRGRRTLRRLLVDVAASRGYLRGATAA

>ECFp140340 ECF12 ECF12s2 Mycolicibacterium peregrinum

1 MQADVDACRAERFERDALPLVDQLYAAARRYTRNSADAEDLVQETMLKAY
51 SSFHTYQDGSNIRAWMFRILSNTWINTYRTAQRRPQEVFPEMLSDAQLAE
101 AAQRSPLGVASAELAALESMGDEEVRDAMRALPELQSIVVYYADVAGFRY
151 KEIAEIMQIPVGTVMSRLHRGRRNLRELLTDVGVARRYRSGTRLPCSAA

>ECFp140346 ECF12 ECF12s2 Nonomuraea wenchangensis

1 MTDEQRQDWFERDVVPVTSQLFASAMRLTRNAADAEDLVQETVAKAYTSY
51 HQFREGTNLKAWLHRILTNNFINDYRKKQRSPKLSAAEEIEDWQLHAAES
101 HSSTGLRSAETEALDRLPDSVVMNALRSLPEDFRVAVYLADVEGFPYKEI
151 AERMGTPIGTVMSRLHRGRRQLRGMLEDYAREEGAVRVPSPRAA

Name Aliases LCA Taxa Group Subgroup
ECFp140371
  • RNA polymerase sigma factor RpoE
  • U874_RS0107360
Leucobacter sp. PH1c ECF12 ECF12s2

>ECFp140371 ECF12 ECF12s2 Leucobacter sp. PH1c

1 MTDTASQARLEQRFTDEALPLLDQLYGAAMKMTRNPPDAQDLVQETFAKA
51 FAAFASFEEGTNLKAWLYRIMTNAYINTYRKKQREPHLGAVEELEDWQLG
101 GAESTTAMSARSAEAEAIDRTPDTVVTDALNALPEDFRMAVYLADVEGFS
151 YQEIADIAGVPIGTVMSRLHRGRARLRKSLGEYAREQGVGLTTKPAQKKT
201 TAKRTAKGDAS

>ECFp140362 ECF12 ECF12s2 Mycobacteroides abscessus

1 MACLERPMSVPIRMVGVATERTAVTSMDSAAELPGLVHVETEAERVARFE
51 RDALPLLDQLYGAALRMTRNPADAEDLVQETMVKAYAGFGTFKEGTNLKA
101 WLYRILTNTYINIYRKKQRQPAEYPTEEITDWQLAANAEHTSTGLRSAEI
151 EALDGLPDDEIKEALNKLPEEFRMAVYYADVEGFPYKEIAEIMDPRLALL
201 CRGCTAAVVSCATCCPKWPRTADSCATMSWRRAGHD

>ECFp140390 ECF12 ECF12s2 Actinomyces sp. VUL4_3

1 MDKVVEDQKQSMSEGQAGTFEELAMPLLDVAYSSAMRLTRNQQDAEDLVQ
51 DTFAKAFSAFSQYQQGTNFKAWLLRILKNTFINQYRKAQRSPAVTDSEGV
101 EDWQLADAANHEGTGLLSAEVEALDRLGTQDLIDALDSLSEERRIVVYLA
151 DVEGLSYKEIASALDIPIGTVMSRLNRGRAQLREQLSEVAKHYGIGE

Name Aliases LCA Taxa Group Subgroup
ECFp140452
  • RNA polymerase sigma factor RpoE
  • C795_RS0110730
Leucobacter salsicius M1-8 ECF12 ECF12s2

>ECFp140452 ECF12 ECF12s2 Leucobacter salsicius M1-8

1 MTTSTTPNDLERRFTREALPLLDQLYGAAMKMTRNPQDAQDLVQETYLKA
51 FAAFESFAEGTNLKAWLYRILTNSYINTYRKKQREPYLGVVEELEDWQLG
101 GAESTTAMSSRSAEAEAIDRSPDSVVTSALNELPEDFRMAVYLADVEGFS
151 YQEIADIAEVPIGTVMSRLHRGRARLRKALGEYAAEQGVGTGRASKKGTT
201 R

Name Aliases LCA Taxa Group Subgroup
ECFp140473
  • RNA polymerase sigma factor RpoE
  • H490_0110945
  • ... more
Leucobacter sp. UCD-THU ECF12 ECF12s2

>ECFp140473 ECF12 ECF12s2 Leucobacter sp. UCD-THU

1 MSDTTAHEDQAVLEQRFTREALPLLDQLYGAAMKMTRNPQDAQDLVQETF
51 LKAFSAFASFQEGTNLKAWLYRIMTNSYINTYRKRQREPYLGAVDELEDW
101 QLGGAESTTAMSARSAEAEAIDRTPDTVVSEALNALPEDFRMAVYLADVE
151 GFSYQEIADIAEVPIGTVMSRLHRGRTRLRKTLGEYAREQGVGLSAGGAA
201 TKRTGRTKTKDTEEGATR

Name Aliases LCA Taxa Group Subgroup
ECFp30595
  • RNA polymerase sigma factor RpoE
  • IE99_RS0113190
Spirillospora albida ECF12 ECF12s2

>ECFp30595 ECF12 ECF12s2 Spirillospora albida

1 MTATVQYTDQPESTDRTGRYERDVLPLADPLYASAVRMTRNSADAEDLVQ
51 ETLTKAYVNFHQFQEGTNLKAWLHRILTNNFISGYRKRQREPQRAGHEEL
101 EEWHLSHQEARSAGFRSAEAEALDRIPDAEIVAALRALPREFRDAVYLAD
151 VEGYAYKEIAELMGTPIGTVMSRLHRGRKQLREALAGHRRTHTLAA

Name Aliases LCA Taxa Group Subgroup
ECFp30609
  • hypothetical protein
  • P696_RS0129625
Actinomadura oligospora ATCC 43269 ECF12 ECF12s2

>ECFp30609 ECF12 ECF12s2 Actinomadura oligospora ATCC 43269

1 MAVRPQDETLRHDVDRYERDVLPFVDPLYASAVRMTRNSADAEDLVQETL
51 AKAYVNFHQFQEGTNLKAWLHRILTNNFINTYRKKQREPQRAGSEELEEW
101 QIAQAEAHSSGFRSAESEALDRIPDQRVVTALRSLPQDFRDAVYLADVEG
151 YAYKDIAAMMGTPIGTVMSRLHRGRKQLREALADHPSRVTHELAA

Name Aliases LCA Taxa Group Subgroup
ECFp30629
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-E factor
  • ... more
Corynebacterium ECF12 ECF12s2

>ECFp30629 ECF12 ECF12s2 Corynebacterium

1 MDGNKTDADGVESDRVNGKEPMNNPVKRTGDSDEQLLARFEEDALPLLDQ
51 LYGAALRMTRNPADAQDLVQDAYMKAFQAFGSYKPGTNLKAWMYRILTNT
101 YINQYRKAQRRPRETSDEEVTDWQLADSASHDSTGLQSAEIEALRRIPDK
151 RIQDALMDLSDDYRMVVYYADVEQLPYKEIAEIMDTPIGTVMSRLHRGRR
201 QLRAKLKDVAVEHGIGAAKRPAGKI

>ECFp30647 ECF12 ECF12s2 Actinomadura chibensis NBRC 106107

1 MTAVNTPVRRAGKGPATVDSTRRYERDVLPLADPLYASAVRMTRNSADAE
51 DLVQETLAKAYVNFHQFQEGTNLKAWLHRILTNNFINTYRKKQREPQRAG
101 SEELEEWQIAQAEAHSSGFRSAESEALDRIPDSEVVSALRALPKDFRDAV
151 YLADVEGYPYKEIAEMMGTPIGTVMSRLHRGRKQLREALADHRASHVLAA

>ECFp30642 ECF12 ECF12s2 Corynebacterium

1 MGYVATKITSAKDSQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQET
51 YLKAYKNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPAESSADDLSD
101 FQLYTTAGHDSTGLESAEVEALKLMPDSAISEAMNDLPEDYRMVVYYADV
151 VGLAYKEIAEIMDTPLGTVMSRLHRGRKLLRGALKDVAREEGIGLNHPDM
201 EEKQ

Name Aliases LCA Taxa Group Subgroup
ECFp30667
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Actinomyces cardiffensis F0333 ECF12 ECF12s2

>ECFp30667 ECF12 ECF12s2 Actinomyces cardiffensis F0333

1 MTSLPTTTASADTSAQHSEHSAPEADSSSAELDARFAAEALPLASRLFGA
51 ALGMTRNRADAEDLVQETYLKAYSRFHQYEPGTNITAWLYRILTNTYISH
101 YRKAKRSPARASTEGVEDWQLAEAASHDPIGLKSAEVEALAQMPSEAVKE
151 ALDALSEEQRMVVVLADVDSLSYKEIAATLGIPIGTVMSRLHRGRAALRR
201 SLAHVAAEYGIGGHNE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more