ECF proteins of ECF subgroup ECF12s2

Displaying ECF 21 - 40 of 322 in total
Name Aliases LCA Taxa Group Subgroup
ECFp31801
  • RNA polymerase sigma24 factor
  • IO39_RS07695
Nonomuraea candida ECF12 ECF12s2

>ECFp31801 ECF12 ECF12s2 Nonomuraea candida

1 MTDEQRQDWFERDVVPVTSQLFASAMRLTRNTADAEDLVQETVAKAYTSY
51 HQFREGTNLKAWLHRILTNNFINDYRKKQRSPKLSAAEDIEDWQLHAAES
101 HSSTGLRSAETEALDRLPDSVVMNALRSLPEDFRVAVYLADVEGFAYKEI
151 AERMGTPIGTVMSRLHRGRRQLRGMLEEYAREEGAVRLPAQRAA

>ECFp31798 ECF12 ECF12s2 Mycolicibacterium houstonense

1 MPTCTDETVNVEDCRQARFERDALPLVDQLYAVARRYTRNALDAEDLVQE
51 TMLKAYSSFHTYQDGTNIRAWLFRILSNTWINSYRTAQRRPQEVFAEALT
101 DSQLAEVAQRYPLGVASAELAALESMGDEEVRRAMRALPEPQGIVVYYAD
151 VMGFRYKEIAEIVDVPVGTVMSRLHRGRRNLRALLVDADVAGGFRTGSRL
201 PCTAA

Name Aliases LCA Taxa Group Subgroup
ECFp31768
  • hypothetical protein
  • G583_RS15745
Yaniella halotolerans DSM 15476 ECF12 ECF12s2

>ECFp31768 ECF12 ECF12s2 Yaniella halotolerans DSM 15476

1 MRLDWAGMTHLPSDIPAADDGSRIDPKAETEFQRRARFERDAMQYIDQLY
51 SGALRMTRNPEDAEDLVQEAYARAYSSFHQYKPGTNLRAWLFRILTNTYI
101 NIYRKRQRRPLEADGDGVEDWQMARAAEHSSTGLQSAETEALDYLADSDV
151 KNALAEISEDFRIPVYLADVEGFAYKEIADILDVPIGTVMSRLHRGRRSL
201 RELLTDYAADRGIKGAIELQQKKQANASEEGQNDK

>ECFp31782 ECF12 ECF12s2 Corynebacterium

1 MAENRTGTVDGDALAARFEEEALPLLDQLYGGALRMTRNPADAEDLVQDT
51 YIKAYQAFASFKPGTNLKAWLYRIMTNTYINLYRKKQRQPSQTSADEITD
101 YQLVESQSHTSTGLESAEVEALKNLPDGKIGDAMNQLSPEYRMVVYYADV
151 EDLAYKEIAEIMDVPLGTVMSRLHRGRKQLRGMLKEVAKEQGIGLEHPDM
201 KKNSEA

>ECFp31738 ECF12 ECF12s2 Corynebacterium

1 MEIVAKETISEKELQRRFEAEALPLLDQLYGGALRMTRNPQDAEDLVQET
51 YLKAYKSFHSFTPGTNLKAWLYRIMTNNYINSYRKAKRRPTESSADDLSD
101 FQLYTTAGHDSTGLESAEVAALKDMPDSTISEAMNDLPDDYRMVVYYADV
151 EGLAYKEIAEIMDTPLGTVMSRLHRGRKLLRKALKDVAREQGIGLEHPDM
201 EEK

Name Aliases LCA Taxa Group Subgroup
ECFp31729
Rothia mucilaginosa ECF12 ECF12s2

>ECFp31729 ECF12 ECF12s2 Rothia mucilaginosa

1 MAGTNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAEAKAAAKASAKVQPAKATKGTKATKGVKSPPAGSGSKAPADS

Name Aliases LCA Taxa Group Subgroup
ECFp31724
  • RNA polymerase subunit sigma-24
  • G556_RS0109310
Propionimicrobium lymphophilum DSM 4903 ECF12 ECF12s2

>ECFp31724 ECF12 ECF12s2 Propionimicrobium lymphophilum DSM 4903

1 MVTSTTDSTSDAESTTQPDLRKNETEEERRERFERDALEYVDLLYAAALR
51 MTRNPADAEDVVQDTYAKAYASFHQFKPGTNLRAWLYRILKNSYINTYRK
101 AKRRPQISDAENVEDWQIARAASHTSDGLPSAELEALGRMPDQEILDALE
151 TLTPEFREVVLLADVEGFAYKEIAEIMDTPIGTVMSRLNRARKQLRVLLA
201 DRAAEMGIGRTDTDKSGGEDK

>ECFp31701 ECF12 ECF12s2 Actinomyces sp. S6-Spd3

1 MSELHDTLEPAPQELSQDDRDRLFAEQAIPLIDQLFGAALGMTRNRADAE
51 DLVQETFMKAYTKFHQYQQGTNIKAWLYRILTNTYITHYRKAQRSPKRSG
101 GEEVEDWQLAAAASHDEKGLVSAEAEALDNIPSSQLRTALESLSEDQRVV
151 VLLSDVEGFAYKEIADMLDIPIGTVMSRLHRGRKNLREGLSALAAEYGIG
201 ENHAD

Name Aliases LCA Taxa Group Subgroup
ECFp31677
Rothia ECF12 ECF12s2

>ECFp31677 ECF12 ECF12s2 Rothia

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKA
201 EAKAAAKASTKGQPAKATKGTKAAKGVKSPPAGSGSEAPADS

>ECFp31667 ECF12 ECF12s2 Corynebacterium pseudogenitalium ATCC 33035

1 MTLSAGVAACGDFLDMTGILTLRVRIEIVAKETISEKELQRRFEAEALPL
51 LDQLYGGALRMTRNPQDAEDLVQETYLKAYKSFHSFKQGTNLKAWLYRIM
101 TNNYINSYRKAKRRPTESSADDLSDFQLYTTAGHDSTGLESAEVSALKDM
151 PDATISEAMNDLPDDYRMVVYYADVEGLAYKEIAEIMDTPLGTVMSRLHR
201 GRKMLRKALKDVAREQGIGLEHPDMEEK

Name Aliases LCA Taxa Group Subgroup
ECFp31666
  • RNA polymerase sigma factor RpoE
  • IMCC13023_11860
  • ... more
Candidatus Aquiluna sp. IMCC13023 ECF12 ECF12s2

>ECFp31666 ECF12 ECF12s2 Candidatus Aquiluna sp. IMCC13023

1 MPSKKSEKILSFEAQALPIMPQLYGAALRWTRNPSDAEDLVQETFAKAFV
51 AWEKFEQGTNLKAWLFRIMTNTHINLYNKKAKDKAKTALDDLEDWQVGQG
101 ESVTSRASRSAEIEAMENLPSLAIKNALDQIPEEFRMVVYYAVVEGLPYQ
151 EIADIMGTPVGTVMSRLHRGKKLLRTLLQDYAKQEGYDTGVEVEG

>ECFp31653 ECF12 ECF12s2 Trueperella pyogenes TP8

1 MEGETPAERTARFERDAVPYLNQLYGAAMRLTRNEQDAEDLVQETFAKAF
51 AAFHQFTPGTNLKAWLYRILNNTFISHYRKQRRRPQEADAAEVTDWQEYR
101 ASSHQPRGMESAEMLALELLPNEEIRAALDQLSEDRRTAVYLADVEGFSY
151 QEIADIMDTPIGTVMSRLYRGRTQLREALRDYARDLGYVKETVR

Name Aliases LCA Taxa Group Subgroup
ECFp31650
  • TIGR02947 family RNA polymerase sigma-70 factor
  • HMPREF9238_00544
  • ... more
Actinomyces europaeus ACS-120-V-Col10b ECF12 ECF12s2

>ECFp31650 ECF12 ECF12s2 Actinomyces europaeus ACS-120-V-Col10b

1 MVMETKEQVNEAELRARFEEEALPLLDQLYGAAFRMTGNEADAQDLVQDT
51 YVRAFSSFNTFKPGTNLKAWMYRILKNSFINTYRKNQRRPQQTSDEGVQD
101 WQLLEAASHHPVALESAEAAALDSLPDDTVREALESLSDTYREAVLLADV
151 EGFSYKEIAEIMGTPVGTVMSRIYRGRAQLRTALADYAKRMGIGVKEDHA

Name Aliases LCA Taxa Group Subgroup
ECFp31649
Actinomyces sp. ICM39 ECF12 ECF12s2

>ECFp31649 ECF12 ECF12s2 Actinomyces sp. ICM39

1 MDTTTPSPTPQAPEPAPASSAPDGAELEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYQPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSSQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGAK

Name Aliases LCA Taxa Group Subgroup
ECFp31659
  • RNA polymerase sigma-E factor
  • rpoE
  • ... more
Corynebacterium deserti GIMN1.010 ECF12 ECF12s2

>ECFp31659 ECF12 ECF12s2 Corynebacterium deserti GIMN1.010

1 MAENRTGTVDGDALAARFEEEALPLLDQLYGGALRMTRNPADAEDLVQDT
51 YVKAYQAFASFKPGTNLKAWLYRIMTNTYINMYRKKQRQPSQTSADEITD
101 YQLVESQSHASTGLESAEVEALKHLPDGKIGDAMNQLSPEYRMVVYYADV
151 EDLAYKEIAEIMDVPLGTVMSRLHRGRKQLRGMLKEVAKEQGIGLEHPDM
201 KKNSEA

>ECFp31664 ECF12 ECF12s2 actinobacterium acMicro-4

1 MSTMLEQTRPPIESTVMKASQDDASEASRDFVEQALPFTDQLYAAAMRLA
51 KNPSDAADLVQETFLKAYKAFHHYEDGTNLKAWLYRILTNTYINLYRKRS
101 KEGFLSALDDLEDWQVGGAESLTQSATRSAEAEAIDRMPASVVKDALHSL
151 QEEFRMAVYFADVEGLSYQEIAGIMETPVGTVMSRLYRGRKLLREKLADY
201 ALSQGYDTSKGKGGGAHG

>ECFp31636 ECF12 ECF12s2 Trueperella

1 MDGGDAVTVEETPEERTARFERDAMPYLNQLYGAALRLTRNQQDAEDLVQ
51 ETFAKAFASFHQFTPGTNLKAWLYRILNNAFISSYRKRQRRPQEAAAEVE
101 DWQEYKASFHHSRGLESAEMLALELLPNEDIRQALDQLSDERRTAVYLAD
151 VEGFSYQEIADIMGTPIGTVMSRLYRGRTQLREALRDYARDLGYVKENV

Name Aliases LCA Taxa Group Subgroup
ECFp31632
  • RNA polymerase subunit sigma
  • RNA polymerase sigma-70 factor, TIGR02947 family
  • ... more
Rhodoluna lacicola ECF12 ECF12s2

>ECFp31632 ECF12 ECF12s2 Rhodoluna lacicola

1 MSPFVASSAGFTNPLKGVRLNSKKMKTTEEQAKQTQIQEFEQQALPLMPQ
51 LYGAALRWTRNPSDAEDLVQEAFAKAFVAWGQFQQGTNLKAWLYRIMTNT
101 HINMYNKRAKDQAKGGLDDLEDWQLGSAESVTALSTRSAELEAIDNLPSE
151 TIKTALNEIPEEFRMVVYYAVVDGLPYSEIAEIMGTPVGTVMSRLHRGKK
201 LLKKLLTDYARQEGYDVSDSEANEKNQGVA

Name Aliases LCA Taxa Group Subgroup
ECFp31601
  • RNA polymerase sigma factor RpoE
  • HMPREF2129_06500
  • ... more
Corynebacterium tuscaniense DNF00037 ECF12 ECF12s2

>ECFp31601 ECF12 ECF12s2 Corynebacterium tuscaniense DNF00037

1 MADNDLERRFRDEALPLLDQLYGGALRMTRNPQDAEDLVQETYLKAFNAF
51 GSFKEGTNLKAWMYRIMTNAYINTYRKKQRRPLETSAEDVTDRQLYTTSS
101 HDSTGLQSAEVEALRNMPDTAIADAMNSLNDDYRMVVYLSDVEGLAYKEI
151 AEALDIPIGTVMSRLHRGRKQLRELLKDVANEQGIGLEHSGLEEQK

>ECFp31592 ECF12 ECF12s2 Actinomyces sp. oral taxon 877 str. F0543

1 MDTTTPTPAGVAPPAEQAELRERFMDEAMPLMDQLFGAALGMTRNRADAE
51 DLVQETYLKAYSKFHQYKPGTNIKAWLYRILTNTYITQYRKAQRSPKRAS
101 TDTVEDWQLAEAASHDARGLVSAEVEALEALPSEQLRDALESLSEEHRMV
151 IVMADVESMTYKEIAQALGIPIGTVMSRLNRARRNLRAKLGEVAAEYGIG
201 GAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more