ECF proteins of ECF subgroup ECF12s2

Displaying ECF 221 - 240 of 322 in total

>ECFp31065 ECF12 ECF12s2 Trueperella bernardiae

1 MDGGDAVTVEETPEERTARFERDAMPYLNQLYGAALRLTRNQQDAEDLVQ
51 ETFAKAFASFHQFTPGTNLKAWLYRILNNAFISSYRKRQRRPQEAAAEVE
101 DWQEYKASFHHSRGLESAEMLALELLPNEDIRQALDQLSDERRTAVYLAD
151 VEGFSYQEIADIMGTPIGTVMSRLYRGRTQLREALRDYAGDLGYVKENV

>ECFp31059 ECF12 ECF12s2 Mycobacterium sp. E802

1 MNDDGRVERFERDALPLLDQLYGAARRYTRNAADAEDLVQETLLKAYSGF
51 HTFKPGSNARAWLFRIMYNNWINSYRARQRAVGEQLCEDITDWQVSAEGR
101 HTSSGLRSAEVEALEAMRDDDIADALDAIPAANRMTVYFADVEGYHYREI
151 AALMGTPVGTVMSRLARGRKRLRELLADVARDRGIGRDAGKVQAAVPLS

Name Aliases LCA Taxa Group Subgroup
ECFp31077
  • RNA polymerase sigma factor RpoE
  • H924_03475
  • ... more
Corynebacterium callunae DSM 20147 ECF12 ECF12s2

>ECFp31077 ECF12 ECF12s2 Corynebacterium callunae DSM 20147

1 MAENRTGAVDGDALAARFEEEALPLLDQLYGGALRMTRNPADAEDLVQDT
51 YIKAYQAFASFKPGTNLKAWLYRIMTNTYINMYRKKQRQPSQTSADEITD
101 YQLVESQSHTSTGLESAEVEALKNLPDGQIGEAMNQLSPEYRMVVYYADV
151 EDLAYKDIAEIMDVPLGTVMSRLHRGRKQLRGMLKEVAKEQGIGLGHPDM
201 KENSEAKK

>ECFp31096 ECF12 ECF12s2 Mycolicibacterium smegmatis MKD8

1 MKEFTPHRQWQERVMAVTAEAQVTDHGSSAERFERDVLPLLDQLYGVARR
51 YTRNQADAEDLVQETMVKAYGSFHTYRDGTNIRAWLFKILKNTWINAYHT
101 AQRRPDVVVTDTISDAQLAAVATRSETELASAELAALESMGDSEVRDAVA
151 ALPEHQRMAVYYADVVGMRYQEIADVLGVPVGTVMSRLHRGRRRLREHLI
201 GFAYQSGYLARPAGSAA

>ECFp31072 ECF12 ECF12s2 Nocardiopsis trehalosi NBRC 14201

1 MTTIELDRTATGDRTDDLDFVTAVTPYADQLYPTALRMTRNSADAEDLVQ
51 ETFAKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQDSTDEI
101 KDWQLAAADAHASTGSRSAESEVLDRLPDSAIRHALARLPEEFRVVVYLI
151 DVEGYSYKEVAERMETPLGTVMSRLHRARKQLRGMLADHARERGMRVAA

>ECFp31095 ECF12 ECF12s2 Mycobacterium sp. NAZ190054

1 MVPTPEDTVLERFERDVLPLLDQLYRAARRYTGNAPDAEDLVQETMVKAY
51 GAFHRFENGTNVRAWLFRIMTNTWINSYRRAQCRPDEVLSDDITDAQVAG
101 QASHSSTGLPSAELAALEALGDEEVRDAVGQLREDQRLVVYYADVEGLRY
151 KEIALILDIPVGTVMSRLHRGRRALRRLLVDVATDRGYLRDARAA

>ECFp31075 ECF12 ECF12s2 Corynebacterium striatum

1 MATETISAKERQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQETYLK
51 AYNNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPAESSADELSDFQL
101 YTTSGHDSTGLESAEVEALKLMPDSTISEAMNDLPEDYRMVVYYADVVGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKLLRVALKDVAREVGIGLNHPDMEEK

Name Aliases LCA Taxa Group Subgroup
ECFp31082
  • sigH
  • RNA polymerase sigma factor RpoE
  • ... more
Corynebacterium ECF12 ECF12s2

>ECFp31082 ECF12 ECF12s2 Corynebacterium

1 MVGMATETTSEMLQKQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQE
51 TYLKAFSNFDSFKQGTNLKAWLYRIMTNAYINSYRKAKRRPVESSADELS
101 DFQLYTTSGHDSTGLESAEVEALKQMPDSEISEAMNDLPEDYRMVVYYSD
151 VVGLAYKEIAEVMGTPLGTVMSRLHRGRKLLRAALKDVAREKGIGRNHPE
201 MEEK

>ECFp31136 ECF12 ECF12s2 Tessaracoccus lapidicaptus

1 MMDSPDLAAPDAADVLEDADAAAFEEEALSHLDRLFAAAMRMTRNAADAE
51 DIVQETYAKAFSSRHTFTPGTNLKAWLYRILTNTYINAYRKAQRSPQTSG
101 DEEVSDWQLARAASHDSAGLRSAEMEALDQTPDGAVAEAIAALPENFRMA
151 VLLSDVEGFSYKEIAEIMGTPIGTVMSRLNRGRAQLRDLLADYARDNGIG
201 RRSGGR

>ECFp31125 ECF12 ECF12s2 Mycolicibacterium goodii

1 MSVTAEAEVTDHGSSAERFERDALPLLDQLYGVARRYTRNQADAEDLVQE
51 TMVRAYGSFHTYRDGTNIRAWLFKILTNTWTNSYHTAQRRPDVVVTETIS
101 DAQLAVAARSETDLASAELAALESMGEPEVRAAVAALPEPQRMVVYYADV
151 VGLRYQEVAHVLDVPVGTVMSRLHRGRRRLREHLIEFAYRSGYLARPAGT
201 AA

>ECFp31130 ECF12 ECF12s2 Mycolicibacterium conceptionense

1 MPRNAGGHVDTDDCLSERFERDALPLVDQLYAAARRYTRNVADAEDLVQE
51 TMVKAYSSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELT
101 DAQLAEVAERFPLGVVSAELAALESMGDDDVRQAMRALPESQGIVVYYAD
151 VAGFRYKEIAEILQIPVGTVMSRLHRGRRNLRTLLIGAEVAGGYVGNRMP
201 CAAA

Name Aliases LCA Taxa Group Subgroup
ECFp31127
  • sigH
  • ECF-family sigma factor H
  • ... more
Corynebacterium kroppenstedtii DSM 44385 ECF12 ECF12s2

>ECFp31127 ECF12 ECF12s2 Corynebacterium kroppenstedtii DSM 44385

1 MRRFSVANQADFEEQAMPLLDQLYAGALRMTRNPPDAEDLVQETYMKAYR
51 NFGSFKEGTNLKAWMYRIMTNAYINDYRKAQRRPTESPTDEITDWQLAAN
101 AEHDSTGLESTEVEALKNIPDERIRDALMDLPEDNRMVVYYADVEGMPYK
151 EIAHVMGTPVGTVMSRLHRGRKKLREALKEVASERGIGGVQPAGSSEGSS

>ECFp31162 ECF12 ECF12s2 Mycolicibacterium fortuitum

1 MSADVRMSIDDCLAERFERDALPLVDQLYAAARRYTRNAADAEDLVQDVM
51 AKAYGSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELTDA
101 QLAEVAQRFPLGVVSAELAALEAMGDDEVRQAVRALPESQGIVVYYADVA
151 GFRYKEIADILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYLERPSHNG
201 TAA

Name Aliases LCA Taxa Group Subgroup
ECFp31160
  • RNA polymerase sigma factor RpoE
  • VS93_RS08200
Allosalinactinospora lopnorensis ECF12 ECF12s2

>ECFp31160 ECF12 ECF12s2 Allosalinactinospora lopnorensis

1 MATIELERTTEDEDGAEHLDFVSAVTPYAEQLYPTALRMTRNSADAEDLV
51 QETFTKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQETTDE
101 IKDWQLAAADTHASTGSRSAESEVLEHLPDSTIRHSLAQLPEEFRVVVYL
151 IDIEGYSYKEVAALMETPLGTVMSRLHRARRQLRGMLADYAKERGIQAAA

>ECFp31169 ECF12 ECF12s2 [Zimmermannella] bifida NBRC 103089

1 MHTQSGPAQPAPELEQSVADRTALNLAFAQQAMPFLDELYGHAMRLTRNR
51 SDAEDLVQETYAKALTAFASFKQGTNLRAWLYRIQTNLYITEYRKQQRRP
101 YENPLEELEDWQVGGAESYTAQNHSRSAELEAVENLPADVVKDALAALPD
151 DYRQAVLLADVQGFSYREIAEIMGTPTGTVMSRLHRGRGILREQLREYAR
201 EYGIGTTNDVVTTAKTTKGTAK

>ECFp31159 ECF12 ECF12s2 Corynebacterium pseudogenitalium ATCC 33035

1 MAKETISEKELQRRFEAEALPLLDQLYGGALRMTRNPQDAEDLVQETYLK
51 AYKSFHSFKQGTNLKAWLYRIMTNNYINSYRKAKRRPTESSADDLSDFQL
101 YTTAGHDSTGLESAEVSALKDMPDATISEAMNDLPDDYRMVVYYADVEGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKMLRKALKDVAREQGIGLEHPDMEEK

Name Aliases LCA Taxa Group Subgroup
ECFp31187
  • RNA polymerase sigma factor, sigma-70 family protein
  • WM42_0681
Corynebacterium simulans ECF12 ECF12s2

>ECFp31187 ECF12 ECF12s2 Corynebacterium simulans

1 MATKTTSAKDSQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQETYLK
51 AYKNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPAESSADDLSDFQL
101 YTTAGHDSTGLESAEVEALKLMPDSAISEAMNDLPEDYRMVVYYADVVGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKLLRGALKDVAREEGIGLNHPDMEEK
201 Q

Name Aliases LCA Taxa Group Subgroup
ECFp31194
Actinobaculum suis ECF12 ECF12s2

>ECFp31194 ECF12 ECF12s2 Actinobaculum suis

1 MMSQELVRSAPEETAQQRAARFERDALPFIDQLYGAAMRLTRNPADAEDL
51 VQDTYAKAFAAFHQYKPGTNLKAWLYRILNNTFISNYRKQKRQPQQTDAS
101 DIEDWQEYRAQSHDSRGMRSAEAEALDNLPPAEVREAMSQLSEERRMAVY
151 LADIEGFSYQEIAEIMGTPIGTVMSRLHRGRKQLRELLADYARELGYGRK
201 NESE

Name Aliases LCA Taxa Group Subgroup
ECFp31217
  • RNA polymerase sigma factor RpoE
  • XM48_07880
  • ... more
Leucobacter sp. Ag1 ECF12 ECF12s2

>ECFp31217 ECF12 ECF12s2 Leucobacter sp. Ag1

1 MTPTETTANELEQRFTRDALPYLDQLYGAAMKMTRNPADAQDLVQETFLK
51 AFQAFHTFTEGTNLKAWLYRIMTNSYINTYRKRQRQPLMGAVEDLEDWQM
101 GGAESTTAASSRSAEAEAIDRTPSTVVTEALNALPEDFRMVVYLADVEGF
151 AYQEIADIMETPIGTVMSRLHRGRARLRQSLGSYAREQGIGGAEAPEQTA
201 GGERR

Name Aliases LCA Taxa Group Subgroup
ECFp31205
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-70 factor, ECF subfamily
  • ... more
Mycobacteriaceae ECF12 ECF12s2

>ECFp31205 ECF12 ECF12s2 Mycobacteriaceae

1 MSADVHVSIDDCLAERFERDALPLVDQLYAAARRYTHNAADAEDLVQDVM
51 AKAYGSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELTDA
101 QLAEVAQRFPLGVVSAELAALEAMGDDEVRQAVRALPESQGIVVYYADVA
151 GFRYKEIADILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYLERPSHNG
201 TAA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more