ECF proteins of ECF subgroup ECF12s2

Displaying ECF 201 - 220 of 322 in total
Name Aliases LCA Taxa Group Subgroup
ECFp30833
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-70 factor
  • ... more
Actinomyces odontolyticus ATCC 17982 ECF12 ECF12s2

>ECFp30833 ECF12 ECF12s2 Actinomyces odontolyticus ATCC 17982

1 MDTTTPSPTPQAPELAPASSALDGAELEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYQPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSAQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGTK

>ECFp30835 ECF12 ECF12s2 Actinomyces odontolyticus

1 MDTTTPSPTPQAPEAAPASSALDGAELEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAFQKFHQYQPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSAQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGAK

Name Aliases LCA Taxa Group Subgroup
ECFp30839
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Corynebacterium lipophiloflavum DSM 44291 ECF12 ECF12s2

>ECFp30839 ECF12 ECF12s2 Corynebacterium lipophiloflavum DSM 44291

1 MMPMADTDVHKRFTEEAMPLLDQLYAGALRMTRNPQDAEDLVQETYLKAF
51 NAFDSYKPGTNLKAWLYRIMTNSYINTYRKRQRRPLETSTEDMTDHQLYT
101 TSSHDSTGLESAEVAALKVMPNSRISEAFDELNEDYRMVVYMADVEEMAY
151 KEIAEALDIPLGTVMSRLHRGRKQLRVLLKDVANEQGIGLEEKK

Name Aliases LCA Taxa Group Subgroup
ECFp30872
  • RNA polymerase subunit sigma
  • BH719_03235
Actinomyces ECF12 ECF12s2

>ECFp30872 ECF12 ECF12s2 Actinomyces

1 MDTTTPTPAGAAPPAEQAELRERFMDEAMPLMDQLFGAALGMTRNRADAE
51 DLVQETYLKAYSKFHQYKPGTNIKAWLYRILTNTYITQYRKAQRSPKRAS
101 TDTVEDWQLAEAASHDARGLVSAEVEALEALPSEQLRDALESLSEEHRMV
151 IVMADVESMTYKEIAQALGIPIGTVMSRLNRARRNLRAKLGEVAAEYGIG
201 GAR

>ECFp30861 ECF12 ECF12s2 Corynebacterium

1 MAPMAETDLKTRFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETFLKAY
51 NAFDSFKPGTNLKAWMYRIMTNTYINSYRKKKRRPLETSAEDVTDHQLYT
101 TSSHDSTGLESAEVEALKAMPNSRISEALNALNEDYRMVVYYADVEGMAY
151 KEIAEVMDIPLGTVMSRLHRGRKQLREMLKDVAHEQGIGLDHADMAELKQ
201 QKVEEK

Name Aliases LCA Taxa Group Subgroup
ECFp30856
Rothia mucilaginosa ECF12 ECF12s2

>ECFp30856 ECF12 ECF12s2 Rothia mucilaginosa

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAAAKASAKAQPAKATKAKGVKSPPAGSGSEAPADS

Name Aliases LCA Taxa Group Subgroup
ECFp30880
  • RNA polymerase, sigma subunit, ECF family
  • Bfae_19450
Brachybacterium faecium DSM 4810 ECF12 ECF12s2

>ECFp30880 ECF12 ECF12s2 Brachybacterium faecium DSM 4810

1 MTRTDPAPSPDAGLPDPEQAPQAADSADGPGIGEAADAPAFDFESEALSH
51 LDSLYGGALRMTRNPHDAEDLVQDTFVKAFRARDRFTPGTNMRAWLYRIM
101 TNSYISLYRTRQRRPKEAWTDTVEDWQLAEVAGHTSTGLRSAETEALDRL
151 PDSAVKDALGELREDYRMAVYLADVEGFAYKEIAEIMDTPIGTVMSRLHR
201 GRRQLREKLSDYAYRSGFLRGGTADDEQTTAPKDREEER

>ECFp30913 ECF12 ECF12s2 Mycolicibacterium fortuitum subsp. acetamidolyticum

1 MHVSIDDCLAERFERDALPLVDQLYAAARRYTHNAADAEDLVQDVMAKAY
51 GSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELTDAQLAE
101 VAQRFPLGVVSAELAALEAMGDDEVRQAVRALPESQGIVVYYADVAGFRY
151 KEIADILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYLERPSHNGTAA

Name Aliases LCA Taxa Group Subgroup
ECFp30905
  • RNA polymerase subunit sigma
  • WM42_RS03265
Corynebacterium ECF12 ECF12s2

>ECFp30905 ECF12 ECF12s2 Corynebacterium

1 MGYVATKTTSAKDSQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQET
51 YLKAYKNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPAESSADDLSD
101 FQLYTTAGHDSTGLESAEVEALKLMPDSAISEAMNDLPEDYRMVVYYADV
151 VGLAYKEIAEIMDTPLGTVMSRLHRGRKLLRGALKDVAREEGIGLNHPDM
201 EEKQ

Name Aliases LCA Taxa Group Subgroup
ECFp30923
  • RNA polymerase sigma24 factor
  • ACU19_06930
  • ... more
Actinobaculum suis ECF12 ECF12s2

>ECFp30923 ECF12 ECF12s2 Actinobaculum suis

1 MMSQELVRSAPEETAQQRAARFERDALPFIDQLYGAAMRLTRNPADAEDL
51 VQDTYAKAFAAFHQYKPGTNLKAWLYRILNNTFISNYRKQKRQPQQTDAS
101 DIEDWQEYRAQSHDSRGMRSAEAEALDNLPPAEVREAMSQLSEERRMAVY
151 LADIEGFSYQEIAEIMGTPIGTVMSRLHRGRKQLRELLADYARELGYGRK
201 DESE

>ECFp30931 ECF12 ECF12s2 Cellulomonas flavigena

1 MDTTTHAPTPTATTQAPASSTQDDAQLQARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITGYRKAQ
101 RSPKRASTDTVEDWQLAEAASHAESGLKSAEVEALEALPSTQLREALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRASLADV
201 AAEYGIGGAK

Name Aliases LCA Taxa Group Subgroup
ECFp30956
Sanguibacter keddieii ECF12 ECF12s2

>ECFp30956 ECF12 ECF12s2 Sanguibacter keddieii

1 MDTTTPSPTLRAPELAPASSATDGAALEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYKPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSSQLREALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGAK

Name Aliases LCA Taxa Group Subgroup
ECFp30951
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-70 factor
  • ... more
Pseudopropionibacterium propionicum ECF12 ECF12s2

>ECFp30951 ECF12 ECF12s2 Pseudopropionibacterium propionicum

1 MMEETDTTLLDAAELGLAFENEALTHLDRLYSAALRMTRNPADAEDLVQE
51 TYAKALRGRDSFKPGTNMKAWLYRILTNTYINSYRKAARSPQMSGEEEVT
101 DRQLARAASHDSQGLRSAEMEALDNTPDAAVAEAMAGLAENYRLVVYLSD
151 VEGFSYKEIATIMGTPIGTVMSRLNRGRAQLRKSLADYAADRGIGGARA

>ECFp30987 ECF12 ECF12s2 Cutibacterium granulosum TM11

1 MSEPAGAVDVAKETDEERAARFERDALGYLDQLYGAALRMTRNRADAEDV
51 VQEAFIKAFSSFHQFKPGTNLKAWLFRILTNTYINGYRKAQRRPQTADGD
101 DVEDWQIARAASHDATGLRSAEVEALDTMPDERIREALDSLSDDFRQVVM
151 LADVEGFAYKEIAEIMGTPIGTVMSRLNRARKQLRAQLTEVAGARGIGPM
201 AGQISDETYEPLTMMQERA

>ECFp31015 ECF12 ECF12s2 Corynebacterium stationis

1 MAANTTRRTPVADSFEEQALPLLDQLYGGALRMTRNPQDAEDLVQETYLK
51 AFNAFDSYKEGTNLKAWLYRIMTNTYINSYRKAKRRPTESSADELTDFQL
101 YTTSGHDSTGLESAEVAALKSMPNQTVSEAMNDLPEDYRMVVYYADVVGL
151 AYKEIADVMETPLGTVMSRLHRGRKLLRKALKDVAREQGIGIGHPDMEDN

Name Aliases LCA Taxa Group Subgroup
ECFp31028
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Leucobacter chromiiresistens ECF12 ECF12s2

>ECFp31028 ECF12 ECF12s2 Leucobacter chromiiresistens

1 MLPAAVASRIESVSDTAAQAKLEQRFTSEALPMLDQLYGAAMKMTRNPQD
51 AQDLVQETFLKAFSAFASFQEGTNLKAWLYRIMTNSYINTYRKRQREPHL
101 GAVDELEDWQLGGAESTTAMSSRSAEAEAIDRTPDSVVTTALNALPEDFR
151 IAVYLADVEGFSYQEIADIAEVPIGTVMSRLHRGRARLRKALGEYANEQG
201 VGLSAGAKQTKKGAAR

Name Aliases LCA Taxa Group Subgroup
ECFp31042
  • RNA polymerase sigma factor RpoE
  • CCASEI_RS10660
Corynebacterium casei ECF12 ECF12s2

>ECFp31042 ECF12 ECF12s2 Corynebacterium casei

1 MAANTTRRTPVADSFEEQALPLLDQLYGGALRMTRNPQDAEDLVQETYLK
51 AFNAFDSYKQGTNLKAWLYRIMTNTYINSYRKAKRRPTESSADELTDFQL
101 YTTSGHDSTGLESAEVAALKAMPDSTISEAMNDLPEDYRMVVYYADVAGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKLLRKALKDVARDQGIGLGHPDMEDN

>ECFp31058 ECF12 ECF12s2 Propionibacterium sp. KPL1844

1 MTIPTDGQPLPRHSDPSGHGGLSEPAGAVDVAKETDEERAARFERDALGY
51 LDQLYGAALRMTRNRADAEDVVQEAFIKAFSSFHQFKPGTNLKAWLFRIL
101 TNTYINGYRKAQRRPQTADGDDVEDWQIARAASHDATGLRSAEVEALDTM
151 PDERIREALDSLSDDFRQVVMLADVEGFAYKEIAEIMGTPIGTVMSRLNR
201 ARKQLRAQLIEVAGARGIGPMAGQISDETYEPLTMMQERA

>ECFp31062 ECF12 ECF12s2 Mycolicibacterium peregrinum

1 MPMSTGRHVSFDDDCRAERFERDALPLVDQLFAAARRYTRNMADAEDLVQ
51 ETMVKAYSSFHTYQDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADEL
101 SDAQLAEVAQRFPLGVASAELAALESMGDDEVRGAMRALPESQGVVVYYA
151 DVAGFRYREIAEILQIPVGTVMSRLHRGRRALRSRLVEMAAARGYLDHPS
201 HDGTAA

>ECFp31067 ECF12 ECF12s2 Mycolicibacterium goodii

1 MICDAAAAPKDGPGTELSARFERDVVPLVDRLYGAALRLTADPQDAEDLV
51 QETVLRAYLGFHTFREGSNLMAWLYRILHNTWINLYRKRRRRPMEVSMEG
101 VTDHEVLRFRHALRSAEVAALEALPDNEIREALMDLREQNRIVVYYADVE
151 GLSYKQIAEITGTALGTVMSRLHRGRRQLRTALRHVAEQRGLVSEGVHET
201 DQ

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more