ECF proteins of ECF subgroup ECF12s2

Displaying ECF 1 - 20 of 322 in total

>ECFp30426 ECF12 ECF12s2 Rothia mucilaginosa

1 MAETNTAADTRELRERFTADAMQYVDQLYAAALRMSRNSADAEDLVQETY
51 MKAFASYHQFTEGTNLKAWLYRILTNTYINLYRKRQREPQQSQGETVEDW
101 QLAQAGEHDAVGLRSAEAEALSALPNTEVREALNELSEDFRMVVYYSDVE
151 GFAYKDIAEILDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKV
201 EAKAEAKAAAKASAKGQPAKATKGTKAAKGVKSPPAGSSSEAPADS

>ECFp30467 ECF12 ECF12s2 Varibaculum cambriense DORA_20

1 MELMKTEILEAERVGTAAPPKTVALERGHRPAGEDGNGSVSDPLATGDNN
51 VLLSDRFSKEALPLLDQLYAGALRLTRKPADAEDLVQDTYMQAFRKFNQY
101 QPGTNLKAWMYRIMTNTFINQYRLKTRRPQEQGSGEITDHAQVAQSLHHG
151 EGMPSAETTALERLPNETIQAAFEKLSDEHRAVVYLADVEQFSYKEISQI
201 LGIPLGTVMSRLHRGRSQLREELSEYAREYGIGVK

Name Aliases LCA Taxa Group Subgroup
ECFp140417
Agrococcus baldri ECF12 ECF12s2

>ECFp140417 ECF12 ECF12s2 Agrococcus baldri

1 MPTMTLEAPRSTLDSPAMTSEQDESGQVDASAAAAARRDDFAEQAMQYAD
51 QLYAAAMRMTRNPADAADLVQETLLKAYAAYGSFKPGTNLRAWLYRIQTN
101 TYINTYRKQQRRPFEAPLDDMEEWQIGDAESFTSTSSRSAEAEAIHRMPS
151 GIVKDALQQVPVDFRMAVYWVDVEGLSYAETAEVMETPTGTVMSRLHRGR
201 KLLRGLLADYAREQGIEVPESTEKGKKP

>ECFp140451 ECF12 ECF12s2 Mycolicibacterium neworleansense

1 MPMSTGMHVNGDDCLAARFERDALPLVDQLFAAARRYTRNVADAEDLVQE
51 TMVKAYGSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELT
101 DAQLAEVGQRFPLGVVSAELAALESMGDDDVRQAMRALPESQGIVVYYAD
151 VAGFRYKEIAEILQIPVGTVMSRLHRGRRALRSRLVEMAVARGYLDRPSR
201 NGTAA

>ECFp30711 ECF12 ECF12s2 Actinomadura kijaniata NBRC 14229

1 MNDPALSRRQTRFEREAVPYLNQLYAAALRMTRNRADAEDLVQDTYTKAF
51 TSFHQFKQGTNLRAWLYRILTNNFINGYRRQQRQPLRSGTDQVEDWQLTR
101 AEAHLPGGLKSAESQALERLPDPKVKQALNDLPEEFRLAVYLSDVEGFSY
151 KEIARILNVPIGTVMSRLHRGRRRLRVALDDYAHRYAYVS

Name Aliases LCA Taxa Group Subgroup
ECFp30906
  • RNA polymerase subunit sigma
  • AK829_07040
  • ... more
Corynebacterium riegelii ECF12 ECF12s2

>ECFp30906 ECF12 ECF12s2 Corynebacterium riegelii

1 MATMPETELATDLKARFTEEAMPLLDQLYGGALRMTRNPQDAEDLVQETY
51 LKAYSAFDSFKPGTNLKAWLYRIMTNTYINNYRKMKRRPLETSAEDVTDS
101 QLYTSSSHDSTGLESAEVEALKMMPNSRISDALNSLNEDYRMVVYYADVE
151 GLAYKEIAEVMEIPLGTVMSRLHRGRKQLREMLKDVAHEQGIGLEEK

>ECFp30944 ECF12 ECF12s2 Corynebacterium simulans

1 MATKITSAKDSQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDLIQETYLK
51 AYKNFGSFKQGTNLKAWLYRIMTNTYINSYRKAKRRPAESSADDLSDFQL
101 YTTAGHDSTGLESAEVEALKLMPDSAISEAMNDLPEDYRMVVYYADVVGL
151 AYKEIAEIMDTPLGTVMSRLHRGRKLLRGALKDVAREEGIGLNHPDMEEK
201 Q

Name Aliases LCA Taxa Group Subgroup
ECFp30991
Trueperella pyogenes ECF12 ECF12s2

>ECFp30991 ECF12 ECF12s2 Trueperella pyogenes

1 MTDRVEGETPAERTARFERDAVPYLNQLYGAAMRLTRNEQDAEDLVQETF
51 AKAFAAFHQFTPGTNLKAWLYRILNNTFISHYRKQRRRPQEADAAEVTDW
101 HEYRASSHQPRGMESAEMLALELLPNEEIRAALDQLSEDRRTAVYLADVE
151 GFSYQEIADIMDTPIGTVMSRLYRGRTQLREALRDYARDLGYVKETVR

Name Aliases LCA Taxa Group Subgroup
ECFp31009
  • hypothetical protein
  • RNA polymerase sigma24 factor
  • ... more
Trueperella pyogenes ECF12 ECF12s2

>ECFp31009 ECF12 ECF12s2 Trueperella pyogenes

1 MTDRVEGETPAERTARFERDALPYLNQLYGAAMRLTRNEQDAEDLVQETF
51 AKAFAAFHQFTPGTNLKAWLYRILNNTFISHYRKQRRRPQEADAAEVTDW
101 QEYRASSHQPRGMESAEMLALELLPNEEIRAALDQLSEDRRTAVYLADVE
151 GFSYQEIADIMDTPIGTVMSRLYRGRTQLREALRDYARDLGYVKETVR

>ECFp31196 ECF12 ECF12s2 Mycolicibacterium vulneris

1 MPMSTGMHVNGDDCRAERFERDALPLVDQLFAAARRYTRNMADAEDLVQE
51 TMVKAYSSFHTYRDGTNIRAWLFRILTNTWINSYRTAQRRPQEVFADELT
101 DAQLAEVAQRFPLGVVSAELAALEAMGDDEVRQAMRSLPESQGIIVYYAD
151 VEGFRYKEIAEILQIPVGTVMSRLHRGRRNLRARLVEADVATEYVGNRLP
201 CTAA

Name Aliases LCA Taxa Group Subgroup
ECFp31282
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Corynebacterium singulare ECF12 ECF12s2

>ECFp31282 ECF12 ECF12s2 Corynebacterium singulare

1 MATDTTSATETAEEQREQQRLFEEQALPLLDQLYGGAMRLTRNPQDAEDL
51 IQETYLKAYKNFSSFKQGTNLKAWLYRIMTNTYINSYRKAQRRPTESSAD
101 ELSDFQLYTTSGHDSTGLESAEVAALKQMPDSQISEAMNDLPEDYRMVVY
151 YADVEGLAYKEIAEVMGTPLGTVMSRLHRGRKLLRAALKDVAREKGIGRD
201 HPEMMSDTEEK

Name Aliases LCA Taxa Group Subgroup
ECFp31457
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Mycolicibacterium setense ECF12 ECF12s2

>ECFp31457 ECF12 ECF12s2 Mycolicibacterium setense

1 MSTDMQLGSDCPAERFERDALPLVDQLFAAARRYTRNTADAEDLVQETMV
51 KAYSSFHTYRDGSNIRAWLFRILTNTWINSYRTAQRRPQEVFADELSDAQ
101 LAEVAQRFPFGVVSAELAALEAMGDDDVRQAMRALPESQGVVVYYADVAG
151 FRYKEIADILQIPAGTVMSRLHRGRRALRSRLVEMAVARGYLEPPSRNGT
201 AA

>ECFp31480 ECF12 ECF12s2 Actinobacteria

1 MDTTTPSPTPQAPEAAPASSALDGAELEARFMDEAMPLMNQLFGAALGMT
51 RNRADAEDLVQETYLKAYQKFHQYQPGTNIKAWLYRILTNTYITSYRKAQ
101 RSPKRASSDTVEDWQLADAASHSEVGLKSAEVEALEALPSAQLRDALDSL
151 SEEHRMVVLMADVEGMSYKEIAEELGVPMGTVMSRLNRARKNLRSALADV
201 AAEYGIGGAK

>ECFp31535 ECF12 ECF12s2 Actinomadura macra NBRC 14102

1 MPVRRNAPGTANGEKTERYERDVLPLADPLYISAVRMTRNSADAEDLVQE
51 TLAKAYVNFHQFQEGTNLKAWLHRILTNNFINTYRKKQREPQRAGSEELE
101 EWQIAQAEAQASGFRSAESEALDRIPDSEVVTALRALPKDFRDAVYLADV
151 EGYPYKEIAEMMGTPIGTVMSRLHRGRKQLREALADHRRAHILAA

Name Aliases LCA Taxa Group Subgroup
ECFp31632
  • RNA polymerase subunit sigma
  • RNA polymerase sigma-70 factor, TIGR02947 family
  • ... more
Rhodoluna lacicola ECF12 ECF12s2

>ECFp31632 ECF12 ECF12s2 Rhodoluna lacicola

1 MSPFVASSAGFTNPLKGVRLNSKKMKTTEEQAKQTQIQEFEQQALPLMPQ
51 LYGAALRWTRNPSDAEDLVQEAFAKAFVAWGQFQQGTNLKAWLYRIMTNT
101 HINMYNKRAKDQAKGGLDDLEDWQLGSAESVTALSTRSAELEAIDNLPSE
151 TIKTALNEIPEEFRMVVYYAVVDGLPYSEIAEIMGTPVGTVMSRLHRGKK
201 LLKKLLTDYARQEGYDVSDSEANEKNQGVA

Name Aliases LCA Taxa Group Subgroup
ECFp31666
  • RNA polymerase sigma factor RpoE
  • IMCC13023_11860
  • ... more
Candidatus Aquiluna sp. IMCC13023 ECF12 ECF12s2

>ECFp31666 ECF12 ECF12s2 Candidatus Aquiluna sp. IMCC13023

1 MPSKKSEKILSFEAQALPIMPQLYGAALRWTRNPSDAEDLVQETFAKAFV
51 AWEKFEQGTNLKAWLFRIMTNTHINLYNKKAKDKAKTALDDLEDWQVGQG
101 ESVTSRASRSAEIEAMENLPSLAIKNALDQIPEEFRMVVYYAVVEGLPYQ
151 EIADIMGTPVGTVMSRLHRGKKLLRTLLQDYAKQEGYDTGVEVEG

Name Aliases LCA Taxa Group Subgroup
ECFp31768
  • hypothetical protein
  • G583_RS15745
Yaniella halotolerans DSM 15476 ECF12 ECF12s2

>ECFp31768 ECF12 ECF12s2 Yaniella halotolerans DSM 15476

1 MRLDWAGMTHLPSDIPAADDGSRIDPKAETEFQRRARFERDAMQYIDQLY
51 SGALRMTRNPEDAEDLVQEAYARAYSSFHQYKPGTNLRAWLFRILTNTYI
101 NIYRKRQRRPLEADGDGVEDWQMARAAEHSSTGLQSAETEALDYLADSDV
151 KNALAEISEDFRIPVYLADVEGFAYKEIADILDVPIGTVMSRLHRGRRSL
201 RELLTDYAADRGIKGAIELQQKKQANASEEGQNDK

>ECFp31852 ECF12 ECF12s2 Mobiluncus curtisii ATCC 51333

1 MGQTLEKSLAKPARARGAINRPPSVSTALCTLDWAPMSETVNSAPPHEAR
51 SKTEQRFETEVMPFLNQLYSGALRLTRNPHDAEDLVQETFLKAFRSFDSF
101 QEGTNLLAWLYRIMTNTFINSYRKDQRRPRTETMAEITDYQLSQDDSNRE
151 SRSAESLALDRLGTQDILDALDALPDEYREAVYLADVEGLAYKEIAEILD
201 IPSGTVMSRLHRGRAKLRKMLRERVEAEVQMS

>ECFp178527 ECF12 ECF12s2 Varibaculum sp. Marseille-P2802

1 MAERFSAEALPLLDQLYAGALRLTRRPADAEDLVQETYMQAFRKFNQYQP
51 GTNLKAWMYRIMTNTLLNQYRSKSRRPQEDGSGEISDQAQVAQSLHHQVG
101 MPSAETIALERVPNETIQAAFDQLSDENRTVVYLADVEQFSYKEISQILG
151 IPLGTVMSRLHRGRSQLRKELAEYAREYGIGVER

Name Aliases LCA Taxa Group Subgroup
ECFp100748
  • RNA polymerase sigma factor
  • BN381_110017
  • ... more
Candidatus Microthrix parvicella ECF12 ECF12s2

>ECFp100748 ECF12 ECF12s2 Candidatus Microthrix parvicella

1 MEFADSLYSTALRMTRNPADAEDLLQETLLKGYRAYGRFEAGTNLRAWLF
51 RILTNTYINTYRAKQRRPDESDLADVEDLFLYRRLGGLEAARRGRSAEDE
101 LMDLFTEGEVADALEALPDNFRVPVLLADVEGFAYKEIAEMLDIPIGTVM
151 SRLHRGRKALQKSLHTFGVERRLADPDPEPGTLATTSLS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more