ECF proteins of ECF subgroup ECF12s19

Displaying all 13 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp30917
  • rpoE
  • RNA polymerase sigma24 factor
  • ... more
Corallococcus coralloides DSM 2259 ECF12 ECF12s19

>ECFp30917 ECF12 ECF12s19 Corallococcus coralloides DSM 2259

1 MMLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMR
51 AYRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHE
101 RFVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEF
151 SYKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAEGQGVFRHDGEPVQA
201 PADLEEFRRRKKAG

Name Aliases LCA Taxa Group Subgroup
ECFp30283
  • rpoE
  • RNA polymerase sigma factor
  • ... more
Stigmatella aurantiaca DW4/3-1 ECF12 ECF12s19

>ECFp30283 ECF12 ECF12s19 Stigmatella aurantiaca DW4/3-1

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAEGQGVFRHDAEPVKAP
201 ADLEEYRHRKKTG

Name Aliases LCA Taxa Group Subgroup
ECFp666
  • rpoE1
  • RNA polymerase sigma24 factor
  • ... more
Myxococcus ECF12 ECF12s19

>ECFp666 ECF12 ECF12s19 Myxococcus

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDALPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKNLREYAEGQGVFRHDGEPVNAP
201 ADLEEYRHRKKTG

Name Aliases LCA Taxa Group Subgroup
ECFp31634
  • RNA polymerase sigma factor RpoE1
  • MYSTI_03805
  • ... more
Myxococcus stipitatus DSM 14675 ECF12 ECF12s19

>ECFp31634 ECF12 ECF12s19 Myxococcus stipitatus DSM 14675

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAVGQGVFRHEGESADAP
201 SNLEEYRQRKKTG

Name Aliases LCA Taxa Group Subgroup
ECFp31508
  • RNA polymerase sigma-70 factor, ECF subfamily
  • RNA polymerase sigma24 factor
  • ... more
Archangium gephyra ECF12 ECF12s19

>ECFp31508 ECF12 ECF12s19 Archangium gephyra

1 MLDFRQNNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERSVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDALPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAQGSGVLRQEEPAQAAN
201 ADGTAAAGSPTNLDDYRRRKKVG

Name Aliases LCA Taxa Group Subgroup
ECFp31245
  • RNA polymerase sigma24 factor
  • RNA polymerase sigma factor RpoE1
  • ... more
Myxococcus fulvus HW-1 ECF12 ECF12s19

>ECFp31245 ECF12 ECF12s19 Myxococcus fulvus HW-1

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKNLREYAEGQGVFRHDGEPVNAP
201 ADLEEYRHRKKTG

Name Aliases LCA Taxa Group Subgroup
ECFp31002
Myxococcus hansupus ECF12 ECF12s19

>ECFp31002 ECF12 ECF12s19 Myxococcus hansupus

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKNLREYAEGQGVFRHDGEPVNAP
201 ADLEEYRNRKKTG

>ECFp30183 ECF12 ECF12s19 Myxococcus fulvus

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAVGQGVFRHEGEGVETP
201 ANLEEYRQRKKTG

Name Aliases LCA Taxa Group Subgroup
ECFp30164
  • RNA polymerase sigma-70 factor, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Cystobacter fuscus DSM 2262 ECF12 ECF12s19

>ECFp30164 ECF12 ECF12s19 Cystobacter fuscus DSM 2262

1 MLDFRQNNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERSVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDALPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLKEYAEGTGVLRQEAGGEPVN
201 LENATASLDEYRRRKKVG

>ECFp30131 ECF12 ECF12s19 Archangium

1 MLDFRQNNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERSVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDALPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAQGSGVLRQEGAEAANE
201 EGTAAAGSTTSLDDYRRRKKVG

Name Aliases LCA Taxa Group Subgroup
ECFp29973
  • RNA polymerase sigma-70 factor, ECF subfamily protein
  • RNA polymerase sigma24 factor
  • ... more
Hyalangium minutum ECF12 ECF12s19

>ECFp29973 ECF12 ECF12s19 Hyalangium minutum

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAEGQGVFRHEGEPVAAP
201 ANLEEYRHRKKTG

>ECFp140330 ECF12 ECF12s19 Stigmatella

1 MLDFRQPNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERTVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDSLPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLREYAEGQGVFRHDGEPVKAP
201 ADLEEYRHRKKTG

>ECFp178844 ECF12 ECF12s19 Cystobacter ferrugineus

1 MLDFRQNNRTKQEFEELALAHLDPLYSAALRLTKNERDAEDLVQDTCMRA
51 YRFFDKFERGTNIKAWLFKILTNTFINRYRRKVKERSVVEGVEREAVHER
101 FVSRDATDFAANPEQYFFDRLLSDDVLRAIDALPIDFRLVVILADLQEFS
151 YKEIAEILECPVGTVMSRLFRGRKLLQKTLKEYAEGTGVLRQEAGGAPVN
201 LENATASLDEYRRRKKVG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more