ECF proteins of ECF subgroup ECF12s12

Displaying all 16 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp150091
  • RNA polymerase sigma factor
  • CAP_1994
Chondromyces apiculatus DSM 436 ECF12 ECF12s12

>ECFp150091 ECF12 ECF12s12 Chondromyces apiculatus DSM 436

1 MPFFFSKKPASIAQDLSLAGGEASRPDAFEVELLGHLDTLYSVSCRMTKS
51 STEAEDLVQDTIVKAMRARRQFEPGTNLKAWLLRILTNTFINRYRRGGLE
101 RDLFEGPDAEPLTDGWVGATTMRAMRDPETQALSPLIEAEVQRALDELPD
151 EFRLAVILSDIEELSYKEIAEAMGCPIGTVMSRLHRGRKMLQKTLREQAV
201 LLGIVSEEDGKKSSEAPADLGAYRKRKLGVA

Name Aliases LCA Taxa Group Subgroup
ECFp167968
Minicystis rosea ECF12 ECF12s12

>ECFp167968 ECF12 ECF12s12 Minicystis rosea

1 MPFFFSKKPTSVVQDMGDFAGGGVPPQVDSFEVELLGQLDTLYGVSCRMT
51 RSTSEAEDLVQDTVVKAMRARDQFQPGTNLKAWLLRIMTNTFINRYRRGG
101 MERDVIDGPDAESLTDAWVGATTLRAMRDPETQALSPLVEAEVQRALDDL
151 PAEFRLAVVLSDIEELSYKEIADAMGCPIGTVMSRLHRGRRMLQKTLREH
201 AVAMGIVNEAESARVKETAPADLAAYRRRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp101710
Labilithrix luteola ECF12 ECF12s12

>ECFp101710 ECF12 ECF12s12 Labilithrix luteola

1 MEKKKVVDGFAEEAVGHLDALYAVACKLTRNPSEAEDLVQDTLLKAMRAR
51 DQFNAGTNLKAWLFRILTNTFINKYRRGGLERSVLEGPDADPLVDGWVSA
101 ATMRQLRDPEQQALLPIVEGEVQRALDSLPAEFKLAVVLCDVEEFSYEEI
151 AQIMGCPIGTVMSRLHRGRKLLQRSLYNHALALGIVKGEPVSEAKHEPMI
201 KDEQPADLAAFRARKRGAA

>ECFp77541 ECF12 ECF12s12 Sorangium cellulosum So0157-2

1 MPFFFSKKPASVAQDLSLASCEGGRADAFEIELLGHLDTLYGVSCRMTKS
51 STEAEDLVQDTIVKAMRARDQFEPGTNLKAWLLRILTNTFINRYRRGGLE
101 RGIFDGPDAEPLTDGWVGATTMRAMRDPETQALTPLVEAEVQRALDELPE
151 EFRLAVVLSDIEELSYKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAV
201 LMGIVSEDAAKDAPADLDAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp98981
Sorangium cellulosum ECF12 ECF12s12

>ECFp98981 ECF12 ECF12s12 Sorangium cellulosum

1 MSLSSSEGGRADAFEVELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKA
51 MRAREQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFEGPDAEPLTDG
101 WVGATTMRAMRDPETQALTPLVEAEVQRALDELPEEFRLAVVLSDIEELS
151 YKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSAEAPKEAPA
201 DLDAYRKRKRGVA

>ECFp93183 ECF12 ECF12s12 Sorangium cellulosum

1 MASCEGGRADAFEIELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKAMR
51 ARDQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFDGPDAEPLTDGWV
101 GATTMRAMRDPETQALTPLVEAEVQRALDELPEEFRLAVVLSDIEELSYK
151 EIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSEDAAKDAPADL
201 DAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp91625
Sorangium cellulosum ECF12 ECF12s12

>ECFp91625 ECF12 ECF12s12 Sorangium cellulosum

1 MSLSSSEGGRADAFEVELLGHLDTLYAVSCRMTKSSTEAEDLVQDTIVKA
51 MRARDQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFDGPDAEPLTDG
101 WVGATTMRAMRDPETQALTPLVEAEVQRALDELPEEFRLAVVLSDIEELS
151 YKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSDDAAKEAPA
201 DLDAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp86238
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Chondromyces crocatus ECF12 ECF12s12

>ECFp86238 ECF12 ECF12s12 Chondromyces crocatus

1 MPFFFSKKPASIAQDISLATGEASRPDAFEIELLGHLDTLYSVSCRMTKS
51 STEAEDLVQDTIVKAMRARKQFEPGTNLKAWLLRILTNTFINRYRRGGLE
101 RDLFEGPDAEPLTDGWVGATTMRGMRDPETQALSPLIEAEVQRALDELPD
151 EFRLAVILSDIEELSYKEIADAMGCPIGTVMSRLHRGRKLLQKTLREQAV
201 LLGIVGEDDGKKSSEAPADLGAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp86033
  • ECF-family RNA polymerase sigma factor
  • sce7566
Sorangium cellulosum So ce56 ECF12 ECF12s12

>ECFp86033 ECF12 ECF12s12 Sorangium cellulosum So ce56

1 MPFFFSKKPASVAQDLSLASADGGRADAFEIELLGHLDTLYGVSCRMTKS
51 STEAEDLVQDTIVKAMRARAQFEPGTNLKAWLLRILTNTFINRYRRGGLE
101 RGIFDGPDAEPLTDAWVGATTMRAMRDPETQALTPLVEAEVQRALDALPE
151 EFRLAVVLSDIEELSYKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAV
201 LMGIVSDDAAKDAPADLDAYRKRKRGAA

Name Aliases LCA Taxa Group Subgroup
ECFp85350
Sorangium cellulosum ECF12 ECF12s12

>ECFp85350 ECF12 ECF12s12 Sorangium cellulosum

1 MASCEGSRADAFEIELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKAMR
51 ARDQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFDGPDAEPLTDGWV
101 GATTMRAMRDPETQALTPLIEAEVQRALDELPEEFRLAVVLSDIEELSYK
151 EIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSDDAAKDAPADL
201 DAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp85039
  • ECF family RNA polymerase sigma factor
  • SCE_RS38760
Sorangium cellulosum So ce56 ECF12 ECF12s12

>ECFp85039 ECF12 ECF12s12 Sorangium cellulosum So ce56

1 MSLASADGGRADAFEIELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKA
51 MRARAQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFDGPDAEPLTDA
101 WVGATTMRAMRDPETQALTPLVEAEVQRALDALPEEFRLAVVLSDIEELS
151 YKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSDDAAKDAPA
201 DLDAYRKRKRGAA

Name Aliases LCA Taxa Group Subgroup
ECFp84128
Sorangium cellulosum ECF12 ECF12s12

>ECFp84128 ECF12 ECF12s12 Sorangium cellulosum

1 MSLSSSEGGRADAFEVELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKA
51 MRARDQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFEGPDAEPLTDG
101 WVGATTMRAMRDPETQALTPLIEAEVQRALDELPDEFRLAVVLSDIEELS
151 YKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSADASKEAPA
201 DLDAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp166947
  • ECF family RNA polymerase sigma factor
  • CAP_RS12250
Chondromyces apiculatus DSM 436 ECF12 ECF12s12

>ECFp166947 ECF12 ECF12s12 Chondromyces apiculatus DSM 436

1 MAGGEASRPDAFEVELLGHLDTLYSVSCRMTKSSTEAEDLVQDTIVKAMR
51 ARRQFEPGTNLKAWLLRILTNTFINRYRRGGLERDLFEGPDAEPLTDGWV
101 GATTMRAMRDPETQALSPLIEAEVQRALDELPDEFRLAVILSDIEELSYK
151 EIAEAMGCPIGTVMSRLHRGRKMLQKTLREQAVLLGIVSEEDGKKSSEAP
201 ADLGAYRKRKLGVA

>ECFp166854 ECF12 ECF12s12 Myxococcales bacterium 68-20

1 MSLFSTPPATAKQTSDAFTEEAVGHLDALYAVACKLTRNPAEAEDLVQDT
51 LLKAMRAREQFHAGTNLKAWLFRILTNTFINKYRRGGLERSVLEGPDADP
101 LVDGWVSASTMRQLRDPEQAALMPIVEGEVQRALDALPTEFKLAVILCDV
151 EEFSYEEIAQIMGCPIGTVMSRLHRGRKLLQRSLYNHALALGIVKGEPVS
201 ERANEQPADLAAYRAKRRASA

Name Aliases LCA Taxa Group Subgroup
ECFp104667
Sorangium cellulosum ECF12 ECF12s12

>ECFp104667 ECF12 ECF12s12 Sorangium cellulosum

1 MSLSSSEGGRADAFEVELLGHLDTLYGVSCRMTKSSTEAEDLVQDTIVKA
51 MRARDQFEPGTNLKAWLLRILTNTFINRYRRGGLERGIFEGPDAEPLTDG
101 WVGATTMRAMRDPETQALTPLIEAEVQRALDELPEEFRLAVVLSDIEELS
151 YKEIAEAMGCPIGTVMSRLHRGRKLLQKTLREHAVLMGIVSADAPKEAPA
201 DLDAYRKRKRGVA

Name Aliases LCA Taxa Group Subgroup
ECFp108499
  • RNA polymerase subunit sigma
  • CMC5_RS40155
Chondromyces crocatus ECF12 ECF12s12

>ECFp108499 ECF12 ECF12s12 Chondromyces crocatus

1 MSLATGEASRPDAFEIELLGHLDTLYSVSCRMTKSSTEAEDLVQDTIVKA
51 MRARKQFEPGTNLKAWLLRILTNTFINRYRRGGLERDLFEGPDAEPLTDG
101 WVGATTMRGMRDPETQALSPLIEAEVQRALDELPDEFRLAVILSDIEELS
151 YKEIADAMGCPIGTVMSRLHRGRKLLQKTLREQAVLLGIVGEDDGKKSSE
201 APADLGAYRKRKRGVA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more