ECF proteins of ECF subgroup ECF12s11

Displaying all 20 ECF
Name Aliases LCA Taxa Group Subgroup
ECFp31835
  • RNA polymerase sigma factor
  • hypothetical protein
  • ... more
Actinotalea ferrariae CF5-4 ECF12 ECF12s11

>ECFp31835 ECF12 ECF12s11 Actinotalea ferrariae CF5-4

1 MTAPPRPVRSRGPLTPTAGPPRRSAPAVGPAAPAALPGRLGSVSMSEDTH
51 RAPAEEDDGARAQRFEAEALVYVDQLYSAALRMTRNPTDAEDLVQETVAK
101 AFAAFHQYRPGTNLKAWLYRILTNTFINSYRKKQREPLQSGSDEIEDWQI
151 HRAASHTSAGLRSAEAEALDNLPDSDVKEALQSIGEEFRIAVYLADVEGF
201 AYKEIAEIMGTPIGTVMSRLHRGRRQLRELLTDYARERGLVPASTEGGGR

>ECFp61167 ECF12 ECF12s11 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MVAHRADGAGGEPGRTVRGASGGRLSGDGAGLRPSGGAPRDPAATQPAAG
51 VEQESAQDRTARFERDALVHLDQLYAAALRLTRDRQDAEDLVQETYARAY
101 RCFHQFRPGTNLRAWLQRILTTTFINAYRKKKTEPPQAPAGQIEDWQLAG
151 AASRLPAGGESAETAALRRIFDPAVAEAMSSIPYDLRLVVYLADVEGYAY
201 REIAALTGVPQGTVTSRLHRARRRLRVLLAPYDPGHGAGHGAPRPGEGGP
251 PGCQRPRGGGREAPARGRIPAQRGHRTPAPASVPASAATAGSAVPAVSGA
301 GRPGGGAGQGGAG

Name Aliases LCA Taxa Group Subgroup
ECFp64056
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma factor
  • ... more
Streptomyces cattleya NRRL 8057 = DSM 46488 ECF12 ECF12s11

>ECFp64056 ECF12 ECF12s11 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MEQESAQDRTARFERDALVHLDQLYAAALRLTRDRQDAEDLVQETYARAY
51 RCFHQFRPGTNLRAWLQRILTTTFINAYRKKKTEPPQAPAGQIEDWQLAG
101 AASRLPAGGESAETAALRRIFDPAVAEAMSSIPYDLRLVVYLADVEGYAY
151 REIAALTGVPQGTVTSRLHRARRRLRVLLAPYDPGHGAGHGAPRPGEGGP
201 PGCQRPRGGGREAPARGRIPAQRGHRTPAPASVPASAATAGSAVPAVSGA
251 GRPGGGAGQGGAG

Name Aliases LCA Taxa Group Subgroup
ECFp140216
  • RNA polymerase sigma factor RpoE
  • D476_RS0109720
Nocardiopsis chromatogenes YIM 90109 ECF12 ECF12s11

>ECFp140216 ECF12 ECF12s11 Nocardiopsis chromatogenes YIM 90109

1 MTTIELERTAPQAEEQDKGLDFAEAVAPYADQLYPTALRMTRNAADAEDL
51 VQETFAKAFANFHQFKAGTNLRAWLYRILTNTFINGYRKKQREPRQDSTD
101 EIKDWQLAAAEAHTSTGARSAEAEVLDHMPDSGIRSALAALPEEFRLVVY
151 LVDVEGFSYKEVAARMGTPLGTVMSRLHRARRQLREQLGEYARERGGNAA
201 A

Name Aliases LCA Taxa Group Subgroup
ECFp140299
  • RNA polymerase sigma factor RpoE
  • D471_RS0125585
Nocardiopsis lucentensis DSM 44048 ECF12 ECF12s11

>ECFp140299 ECF12 ECF12s11 Nocardiopsis lucentensis DSM 44048

1 MTTIAADQTSTTGETRAEEQTLDFATAVTPFADQLYPTALRMTRNPADAE
51 DLVQETFAKAFANFHQFRAGTNLRAWLYRILTNTFINSYRKKQREPRQET
101 TDEIKDWQLAAAEAHTSSGMRSAETEVLDHLPDSDIKLALARLPEEFQEV
151 IYLVDIEGYAYKEVAARMGTPLGTVMSRLHRARRQLREMLADYGRERGMR
201 VPA

Name Aliases LCA Taxa Group Subgroup
ECFp140252
  • RNA polymerase sigma factor RpoE
  • D459_RS0122430
Nocardiopsis potens DSM 45234 ECF12 ECF12s11

>ECFp140252 ECF12 ECF12s11 Nocardiopsis potens DSM 45234

1 MTTIELDRTEQQNGETETLDFATAVTPYADQLYPTALRMTRNAADAEDLV
51 QETFTKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQDSTDE
101 IKDWQLAAAEAHSSSGPRSAEAEVLDHMPDSGVRAALAALPEEFRMVVYL
151 VDVEGYPYKEVAARMGTPLGTVMSRLHRARRQLREQLVDYAPAPRSGE

Name Aliases LCA Taxa Group Subgroup
ECFp140355
Sanguibacter marinus ECF12 ECF12s11

>ECFp140355 ECF12 ECF12s11 Sanguibacter marinus

1 MGGDDVATSVTCATEPTCPPDASALTAPAVAAAAASAAQRRAADRSVAGL
51 GSFVMSDETTRAPSAESDAERRDRFERDALGYLDPLYAAALRMTRNPTDA
101 EDLVQETFTKAFAAFHQYRPDTNLKAWLYRILTNTFINTYRKKQREPQKS
151 ATEDIEDWQIARAASHTSTGLRSAEVEALDALPDSDVKDALAALPEDRRI
201 AVYLADVEGFPYKEIAEIMGTPIGTVMSRLHRGRAQLRTLLSEYAQERGL
251 LPAGAKEGS

>ECFp31953 ECF12 ECF12s11 Actinobacteria

1 MPTEISKQGSRDAGGLVRVDREKESAEQRRKRFEDDALQYMNQLYSAALR
51 YTKNPADAQDLVQDTYAKAYVSFHQFEPGTNLKAWLYRILTTTFINTYRK
101 DQRRPQLSDKELEDWQIADASSHTSDQGKSAEDVALEHLPDSDIKRALAE
151 IPEEFRIAVYLADVEGFSYKEIAEIVGVPTGTVMSRLHRGRKQLREKLTD
201 YALELGYVKGGKK

>ECFp31928 ECF12 ECF12s11 Actinobacteria

1 MPTEISKQGSRDAGGLVRVDREKESAEQRRKRFEDDALQYMNQLYSAALR
51 YTKNPADAQDLVQDTYAKAYVSFHQFEPGTNLKAWLYRILTTTFINTYRK
101 DQRRPQLSDKELEDWQIADASSHTSDQGKSAEDVALEHLPDSDIKRALAE
151 IPEEFRIAVYLADVEGFSYKEIAGIVGVPTGTVMSRLHRGRKQLREKLTD
201 YALELGYVKGGKK

Name Aliases LCA Taxa Group Subgroup
ECFp31379
  • RNA polymerase sigma24 factor
  • G437_RS0102000
Actinomyces ECF12 ECF12s11

>ECFp31379 ECF12 ECF12s11 Actinomyces

1 MTQTTKRAPVETLARRRQRFETDALPHLDELYRGALRFTRNPADAEDLVQ
51 DAMVKAYASFDQYRPGTNLRAWLFRILRNTYINKYRKQARRPPTTDSGAV
101 EDWQLAKAASHDSVGLRSAEVQALANMPEGTVRDALMDLPEDYRMAVFLA
151 DVEGFSYKEIAQIMETPEGTVMSRLHRGRARLRKALANYVAEGE

>ECFp30146 ECF12 ECF12s11 Streptomyces

1 MGPVPGTDAGTEHGQAEQPEGQGDTRAESTAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQAMDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp178729 ECF12 ECF12s11 Nocardiopsis sp. CNR-923

1 MTTIAADQTSTTGENRDEGRTLDFAAAVTPFADQLYPTALRMTRNPADAE
51 DLVQETFAKAFANFHQFRAGTNLRAWLYRILTNTFINSYRKKQREPRQET
101 TDEIKDWQLAAAEAHTSSGMRSAETEVLDHLPDSDIKLALARLPEEFQEV
151 IYLVDIEGYAYKEVAARMGTPLGTVMSRLHRARRQLREMLADYGRERGMR
201 VPA

Name Aliases LCA Taxa Group Subgroup
ECFp30656
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma24 factor
  • ... more
Microbispora sp. ATCC PTA-5024 ECF12 ECF12s11

>ECFp30656 ECF12 ECF12s11 Microbispora sp. ATCC PTA-5024

1 MISTDEQRQVWFEREVVPVTNQLYASAMRLTRNPADAEDLVQETVAKAYT
51 SYHQFREGTNLKAWLHRILTNNFINDYRKRQRSPKLSAAEDIEDWQLAAA
101 ESHMSTGLRSAENEALDQLPDSVVMDALRALPEDFRVAVYLADVEGFAYK
151 EIADRMGTPIGTVMSRLHRGRRQLRGMLEDYAREEGVVRVPVHAYAA

Name Aliases LCA Taxa Group Subgroup
ECFp30621
  • RNA polymerase subunit sigma-24
  • hypothetical protein
  • ... more
Cellulomonas carbonis T26 ECF12 ECF12s11

>ECFp30621 ECF12 ECF12s11 Cellulomonas carbonis T26

1 MRGDRPRVHLLMSPCLTAHSAPAAAVPLVRVGVHPLAATTGGPQVVATRL
51 WTSDAGPDRMTPWTSDAAAPSCGLGSWPMSEDTHRAPVEEDEAGRAQRFE
101 TEALVYVDQLYSAALRMTRNPTDAEDLVQETFAKAFAAFHQYRPGTNLKA
151 WLYRILTNTFINSYRKKQREPLQSGTEEIEDWQIARAASHTSTGLRSAEA
201 EALDALPDSDVKDALQAIGEEFRIAVYLADVEGFAYKEIAEIMGTPIGTV
251 MSRLHRGRRQLRELLTDYARERGLVPSNEGGAS

>ECFp140459 ECF12 ECF12s11 Streptomyces radiopugnans

1 MGSIACPSRPVGTRATAAQVDWATLRLAGPVGEAPFRTAERTDRRLFSGS
51 NGSGNGLEAASEEVGPVAATDDAAPREPVETDAERNARFERDALAFLDQM
101 YSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTF
151 INSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDRLPDSD
201 VKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRGMLEDYARERGLVPAGANGAAAPEESHDRKGSGS

>ECFp140419 ECF12 ECF12s11 Streptomyces aidingensis

1 MGSTACPPRPQSSATRVDWATLRPAADRPSRAEDPGRRLFSETNGGGREP
51 DGTRSAAGPTEEVGPVATADDGSVEETPEQRNARFEREALEFLDQMYSAA
101 LRMTRNPADAEDLVQETYAKAYASFHQFRRGTNLKAWLYRILTNTFINSY
151 RKKQREPQRSAAEEIEDWQLARAESHTSNGLQSAESQALDRLPDSDVKQA
201 LQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRDM
251 LEDYARERGLVPAGAEKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp140407
Cellulomonas marina ECF12 ECF12s11

>ECFp140407 ECF12 ECF12s11 Cellulomonas marina

1 MVIDSTTLAPPGAATPFGALGTPVPAARVLVDLRAGYGLLPTAGAASPVA
51 STALTAPGATGAAWDRALRSVAMSQESTPTPDAATTTAATSGAGVDEALA
101 VEPVDDEDTNRAPATEDVAARTDRFEQDALQYLDQLYGAALRMTRNAADA
151 EDLVQETFTKAFAAFHQYRPGTNLKAWLYRILTNTYINSYRKKQREPQQS
201 RSEEIEDWQLARAESHTSTGLRSAETEALDRLADSDVKDALQRIPEDFRM
251 AVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRAQLRDQLRDYARERGL
301 TGASAGEAGR

Name Aliases LCA Taxa Group Subgroup
ECFp140360
Streptomyces pini ECF12 ECF12s11

>ECFp140360 ECF12 ECF12s11 Streptomyces pini

1 MGSIACPSRPVGTRATAAQVDWATLRLAGPVGDVPFPAAEGTDRRLFSGS
51 NGSGNGLEAASEEVGPVAATDDAAPREPVETDAERNARFERDALAFLDQM
101 YSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTF
151 INSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDRLPDSD
201 VKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRGMLEDYARERGLVPAGANGAAAPEESHDRKGSGS

>ECFp30572 ECF12 ECF12s11 Granulicoccus phenolivorans

1 MTLPDTDPDAVGDTDGADATIDLRAEETEAERTERFERDAMAYLDQLYGA
51 ALRMTRNPSDAEDLVQEAYAKAYASFHQFRPGTNLKAWLYRILTNTYINI
101 YRKQQRSPKVADTPEVEDWQEAREASHTARGLRSAETEALERMPDSVVTE
151 ALADLSPDFRLAVILADVEGFSYKEIAEIMGTPIGTVMSRLNRARKQLRS
201 KLADYARETGMLRSPDAPHEEGGR

Name Aliases LCA Taxa Group Subgroup
ECFp178502
Tessaracoccus flavus ECF12 ECF12s11

>ECFp178502 ECF12 ECF12s11 Tessaracoccus flavus

1 MTVAGPTTTNAIHVGFAMVSALFSLLMEQELSTSLADDTLDADAAFEEEA
51 LSHLDRLYAAALRMTRNPADAEDVVQDTYAKAFSSRHTFTPGTNLRAWLY
101 RILTNTYINSYRKAQRSPQTSGDEDVSDWQLARAASHDSAGLRSAEMEAL
151 DQTPDAVVADALAQLPENFRMAVLLSDVEGFSYKEIAEIMGTPIGTVMSR
201 LNRGRAQLRDLLADYARDKGIGRRT

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more