ECF proteins of ECF subgroup ECF12s1

Displaying ECF 161 - 180 of 2311 in total
Name Aliases LCA Taxa Group Subgroup
ECFp31875
  • putative RNA polymerase ECF-type sigma factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Austwickia chelonae ECF12 ECF12s1

>ECFp31875 ECF12 ECF12s1 Austwickia chelonae

1 MFLSHAGLPDSPALLSGSGSGPANTPLRWTTMNDTTHVAGGPASTVTGPG
51 SSGTAPDAVDVANETAAERAQRFEQEAMPYLDQLYSAALRTTRNPTDAED
101 LVQETYAKAFAAFHQYKPGTNVKAWLYRILTNTYINTYRKKQRQPLESDA
151 AEVQDYQLARAESHTSRGLRSAEMEALDHLPDTDVKRALATIGEDFRLAV
201 YLADVEGFSYKEIADIMETPIGTVMSRLHRGRRQLRELLTDYARERGFLG
251 SEA

>ECFp31923 ECF12 ECF12s1 Streptomyces sp. AVP053U2

1 MGSTFCPSRKGRTELDWTVLHAARTVPLRAADGPDRRLSSDSSETVSGPT
51 TTLEEVGPVPGTDAGTEHGQAEQPEGQGDKRVESTAERSARFERDALEFL
101 DQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILT
151 NTFINSYRKKQREPLRSGSEEIEDWQIARAASHMSTGLRSAEAQALDHLP
201 DSDVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRG
251 RRQLRGMLEDYARERGLVPAGAGESNEAKGSRS

Name Aliases LCA Taxa Group Subgroup
ECFp31933
  • RNA polymerase subunit sigma
  • ASD37_20575
  • ... more
Mycobacterium sp. Root135 ECF12 ECF12s1

>ECFp31933 ECF12 ECF12s1 Mycobacterium sp. Root135

1 MPTLCLERPVYEPVLFGGAAREGTVSTQMTDLDGAAPVAAEEPVIETDAE
51 LTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRA
101 GTNLKAWLYRILTNTYINSYRKKQRQPAEYPTDEITDWQLAANAQHTSTG
151 LRSAEVEAMEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAQIMG
201 TPIGTVMSRLHRGRKQLRELLADVARDRGFIRGQIDEPEEVSS

>ECFp31935 ECF12 ECF12s1 Cutibacterium acnes P6

1 MDASGTVDVAEETKTQRAQRFERDALEYLDQLYGAALRMTRNPADAEDVV
51 QEAYAKAFSSFHQFRPGTNLKAWLYRILTNTYINSYRKAQRRPQTSDDQD
101 VEDWQIAKAASHDSNGLRSAELEALDGLPDQQILDALDGLSDEFRQVVLL
151 ADVEGFAYKEIAEIMGTPMGTVMSRLNRARKQLRKQLVDVAGARGIGPRA
201 GQVDEEDLGRSAMARTAGREG

Name Aliases LCA Taxa Group Subgroup
ECFp31974
  • RNA polymerase sigma factor RpoE
  • O5Y_RS10370
Rhodococcus ECF12 ECF12s1

>ECFp31974 ECF12 ECF12s1 Rhodococcus

1 MLEHDRPKDEPSGVTEPIDGAVSETPETADELIARFERDALPLLDQLYGA
51 ALRMTRNPADAEDLVQETYVKAYTAFRSFRAGTNLKAWLYRILTNTYINS
101 YRKKQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEVEALDALPDDDIKA
151 ALQSLPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLRG
201 LLADVAKDRGFNRDGAVDTATVAATETEGVTR

>ECFp31976 ECF12 ECF12s1 Streptomyces glaucescens

1 MGSTFCPSRSSRADLDWTVLHAAKTAPIRAAGGPDRQASPTVGRLSSDSR
51 GTGFGLVRNSEEVGPVSGTDAGTDNGQAELPEGQGISADTNAETTAERSA
101 RFERDALEFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTN
151 LKAWLYRILTNTFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRS
201 AESQALDHLPDSDVKAALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPI
251 GTVMSRLHRGRRQLRGMLEDYARERGLVPAGAGESSNEAKGSGS

>ECFp140326 ECF12 ECF12s1 Mycobacterium tuberculosis

1 MSTATSLLGEKRLARMLARPVSAPGLSGDTANEGTQLIKMADIDGVTGSA
51 GLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQET
101 MVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITD
151 WQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADV
201 EGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAH
251 EGVSS

Name Aliases LCA Taxa Group Subgroup
ECFp674
Frankia sp. EAN1pec ECF12 ECF12s1

>ECFp674 ECF12 ECF12s1 Frankia sp. EAN1pec

1 MTFQHSTPGPRSQDRRVTGPGRGRPVAAPVRTRAVAGVSSGAESGPVRTA
51 AGGPAIGSRRGEGVILVDETNDESTQERGARFERDALPFLDQLYAAALRM
101 TRNPADAEDLVQETFVKAFAAFHQFQEGTNLKAWLYRILTNTFINTYRKR
151 QRQPLQSPTEQVEDWQLAEAESHTSTGLKSAEAEALEHLPDSDITEALQA
201 LPEDFRMAVYLADVEGFSYKEIAEIMGTPIGTVMSRLHRGRRGLRKSLEQ
251 YALERGLVPAGSAENEGGGS

Name Aliases LCA Taxa Group Subgroup
ECFp693
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-70 factor, TIGR02947 family
  • ... more
Mycolicibacterium gilvum ECF12 ECF12s1

>ECFp693 ECF12 ECF12s1 Mycolicibacterium gilvum

1 MVPVMAMKAPSRSVFVLDVIGGAATEGTVFPTMTDTNGLAASPAPADAGE
51 AREETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
101 SGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
151 NAEHTSTGLRSAEVEALELLPDSEIKEALQALPEDFRMAVYYADVEGFPY
201 KEIAEIMETPIGTVMSRLHRGRRQLRELLAGVARDRGFIRGEQLEAPEEV
251 TS

>ECFp95250 ECF12 ECF12s1 Rathayibacter tanaceti

1 MAAMSTATVSTATVSRSTATTAGTGAVPRSVRTPARRRRRPATPVGVSAS
51 ALESLVMTRDDVPRTSPADEAPRRRGGADDRGDRRGVVRRRSSGCSGRSP
101 RTLRGAGPAVHRPALRGRSADDEEPLRRPGPRAGDVRQAFGAFRQFQQGT
151 NLKAWLYRILTNTFINSYRKKQREPYQSAIDELEDWQLGGAESTTATSSR
201 SAEAEAIDHLPDTAVKEALQAIPEDFRLAVYFADVEGFSYQEIADIMKTP
251 VGTVMSRLHRGRRMLRERLTDYARERGFRAAFTSGSTK

Name Aliases LCA Taxa Group Subgroup
ECFp31225
  • RNA polymerase subunit sigma
  • H290_RS0123590
Nocardia sp. 348MFTsu5.1 ECF12 ECF12s1

>ECFp31225 ECF12 ECF12s1 Nocardia sp. 348MFTsu5.1

1 MLDRPDFPAGLEGNVVTEAETPEVSPETSEERFARFERDALPLLDQLYGG
51 ALRMTRNPADAEDLVQETYVKAFSAFHSFKAGTNLKAWLYRILTNTYING
101 YRKKQRQPAQYPTDEITDWQLAATAEHTSQGLRSAEIEALDALPDDEIKA
151 ALQALPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRKQLRE
201 LLADVARERGFNRGTSGHSAAGQSGHKQEVAG

>ECFp31241 ECF12 ECF12s1 Gordonia namibiensis NBRC 108229

1 MSTAAVLEPPVLVEATHLLSGPGSVSLTGNVPVTPLIEGIVVAEAESADT
51 EAAGPGSTATGSAADVSAEKGAPRRADPSESPEELTERFERDALPLLDQM
101 YGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTY
151 INGYRKKQRQPAQYPTDEITDWQLASTAEHTSQGLRSAEIEALDALPDDE
201 IKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQ
251 LRELLADVARERGFHRSATAKGAEVAR

>ECFp31630 ECF12 ECF12s1 Mycobacterium sp. 1164966.3

1 MADLENVRDGATDLDVPASGPPPDETDAELTARFERDAIPLLDQLYGGAL
51 RMTRNPADAEDLLQETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYR
101 KKQRQPAEYPTEAITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKQAL
151 QALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRALL
201 ADVARERGFIRGQQAHEEVSS

>ECFp30032 ECF12 ECF12s1 Propionibacteriaceae

1 MTTRQFEPRMDRHGDVPGTVDVAKETEAERAERFERDALEYLDQLYGAAL
51 RMTRNPADAEDVVQETYAKAFASFHQFRPGTNLKAWLYRILTNTYINSYR
101 KAQRRPQTSDDQDIEDWQIARAASHDSNGLRSAELEALDGLPDQQILDAL
151 DGLSDEFRQVVLLADVEGFAYKEIAEIMGTPIGTVMSRLNRARKQLRKQL
201 VDVAGARGIGPHAGQIDEEDLGRPELARSAGKEGSR

Name Aliases LCA Taxa Group Subgroup
ECFp30641
  • hypothetical protein
  • GORHZ_RS02430
Gordonia rhizosphera NBRC 16068 ECF12 ECF12s1

>ECFp30641 ECF12 ECF12s1 Gordonia rhizosphera NBRC 16068

1 MSATASVSLNDIGQAAPDPLWIIEAPAAVSAPAVTEGIVVVEPESSEQPS
51 AVDIDGNDIDTGADASEAPGVSSQAPRRTDPAESAEELTERFERDALPLL
101 DQMFGAALRMTRNPADAEDLVQETYVKAFSAFSSFREGTNLKAWLYRILT
151 NTYINGYRKKQRQPAQYPTDEITDWQLAATAEHSSTGLRSAEIEALEALP
201 DDDIKAALQALPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRG
251 RRQLRELLADVARERGFNRAARNSESEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30574
  • putative RNA polymerase ECF-subfamily sigma factor
  • AFR_38120
Actinoplanes friuliensis DSM 7358 ECF12 ECF12s1

>ECFp30574 ECF12 ECF12s1 Actinoplanes friuliensis DSM 7358

1 MTPAERTERTERSERTEERRARFERDALPFVDQLYAAGLRMTRNPADAED
51 LVQETFLKAFSAFHQFEEGTNLKAWLYRILTNTYINSYRRKQRQPVQAPT
101 EEISDWQLASSESHTSAGLRSAETEALDKLPDSDIKDALQQLPEDFRLAV
151 YLADVEGFSYKEIADIMNTPIGTVMSRLHRGRRNLRKMLEQYAADRGITR
201 SSGASAAQEA

>ECFp31973 ECF12 ECF12s1 Nocardia otitidiscaviarum IFM 11049

1 MPRPATDAGFAVLTPLAVDSQATAIEGMSVTSDDEMAVDRPGDDDTAMNE
51 GIDDPAVADDNDEESGAVRSTASDADLAARFERDALPLLDQLYGAALRMT
101 RNPADAEDLVQETFAKAYQGFRSFKEGTNLRAWLYRILTNTYINSYRKKQ
151 RQPAQYPTDEITDWQLAATAEHTSTGLRSAEMEALEALPDDDIKRALQEL
201 PEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLKGLLADV
251 ARERGFNRSGSARQEVTQ

>ECFp31807 ECF12 ECF12s1 Mycobacterium

1 MSAATSLLDSPTGAEQLACFLASPAALSVLPGDTAAEGTGVLDMADTDGA
51 TAQEIPDPAPPETDAELMARFERDAIPLLDQLYGGALRMTRNPADAEDLL
101 QETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKRQRQPAEYPTEE
151 ITDWQLASNAEHSSTGLRSAEVEALEALPDNEIKEALQALPEEFRMAVYY
201 ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAKERGFNRGH
251 QAHEEVSS

>ECFp140238 ECF12 ECF12s1 Curtobacterium sp. MCBA15_016

1 MTTDEPHAAPHDLVEETEAQLDAVSEEAALREDEAGDREDEASDREDEAS
51 DREDEASDDQATAVDVVDAKTVSEAELRSLFEDQALPFMDQLYGAAMRMT
101 RNPADASDLVQETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQ
151 RNPYQGTIDELEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQA
201 IPEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLAD
251 HARETGIVPDAASTATMRGRGRKVAAASSRVEGKEAR

Name Aliases LCA Taxa Group Subgroup
ECFp30145
  • hypothetical protein
  • sigma-70 region 2 domain-containing protein
  • ... more
Nocardioides sp. CF8 ECF12 ECF12s1

>ECFp30145 ECF12 ECF12s1 Nocardioides sp. CF8

1 MGDAEAAVVWKTMTESLSETSAADDLLATETAEERSARFERDALPFLDQL
51 YGAAMRMTRNPADAEDLVQETFAKAYSAFHQFKPGTNLKAWLYRILTNTY
101 INTYRKKQRQPQQSMAEDVEDWQLARAESHTSTGLKSAEMEALEHLPDSE
151 VKDALQRLPEEFRLAVYLADVEGFPYKEIAEIMNTPIGTVMSRLHRGRRQ
201 LRDMLSHHVRANDLLPSGATEAK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more