ECF proteins of ECF subgroup ECF12s1

Displaying ECF 141 - 160 of 2311 in total

>ECFp31461 ECF12 ECF12s1 Micromonospora rosaria

1 MPTETRERDERGARQLRELLEGPEWPATASPVGPGARRTGVVSTGTPAGS
51 GSVGGSGRVSSAGKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAG
101 LRMTRNPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSY
151 RKRQRQPIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVKEA
201 LQQLPEEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKL
251 LERYAAERGFSAARSAGGSTAAAGREV

Name Aliases LCA Taxa Group Subgroup
ECFp31483
  • RNA polymerase ECF-type sigma factor
  • putative RNA polymerase ECF-type sigma factor
  • ... more
Gordonia ECF12 ECF12s1

>ECFp31483 ECF12 ECF12s1 Gordonia

1 MAAATLDRGATVRGRPEGARAARGSLDLVEHISGEGKFVSSDSPAPAETP
51 EQLTERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYIKAFSAFASF
101 REGTNLKAWLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAANAEHTS
151 TGLRSAEIEALDALPDDEIKEALSKLPEDFRMAVYYADVEGLPYKEIAEI
201 MDTPIGTVMSRLHRGRRQLRDLLADVARERGFGRTSEVAK

Name Aliases LCA Taxa Group Subgroup
ECFp31497
  • RNA polymerase subunit sigma-24
  • A3G7_RS0121970
Nonomuraea coxensis DSM 45129 ECF12 ECF12s1

>ECFp31497 ECF12 ECF12s1 Nonomuraea coxensis DSM 45129

1 MPRRGTAQGGMNILITMTDEQRQDWFERDVVPVTSQLFASAMRLTRNAAD
51 AEDLVQETVAKAYTSYHQFREGTNLKAWLHRILTNNFINDYRKKQRSPKL
101 SAAEEIEDWQLHAAESHSSTGLRSAETEALDRLPDNVVMNALRSLPEDFR
151 VAVYLADVEGFPYKEIAERMGTPIGTVMSRLHRGRRQLRGMLEEYAREEG
201 ALRVPSQRAA

>ECFp31492 ECF12 ECF12s1 Mycobacterium sp. GA-1199

1 MSEGGQVPTLATDFPVLPVDLPGLYAGTATEGTVFPTMTDSDGSTDSAAP
51 EPQETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
101 AGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
151 NAEHSSTGLRSAEVEALELLPDNEIKEALQALPEDFRMAVYYADVEGFPY
201 KEIAEIMDTPIGTVMSRLHRGRRQLRELLAGVARDRGFIRGQQMDTPEEV
251 SS

>ECFp31537 ECF12 ECF12s1 Mycobacterium kansasii

1 MSTATSLLCEEQLDRFLANPAWPLTLSGDTATEGTVLIKMADIDGETRSE
51 VPGPQPNAETDEQLTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQET
101 MVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEAITD
151 WQLAANAEHSSSGLRSAEVEALEALPDSEIKEALQALPEEFRMAVYYADV
201 EGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRALLADVAKERGFVRGDQPH
251 EEVSS

>ECFp31544 ECF12 ECF12s1 Actinobacteria

1 MGPVPGTDAGTEHGQAEQPEGQGDTRAESTAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31575
  • RNA polymerase sigma factor RpoE
  • MYVA_1519
  • ... more
Mycolicibacterium vaccae ECF12 ECF12s1

>ECFp31575 ECF12 ECF12s1 Mycolicibacterium vaccae

1 MVPVLAMEAPPGPVHVLDVIGGAATEGTVFPRMTDIGGSTAKATLEADTP
51 AREESDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
101 SGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
151 NAEHSSTGLRSAEVEALEALPDNEIKEALQALPEEFRMAVYYADVEGFPY
201 KEIAQIMDTPIGTVMSRLHRGRRQLRELLADVARDRGFLRGEKLDAPEEV
251 TS

>ECFp31579 ECF12 ECF12s1 Streptomyces globisporus subsp. globisporus

1 MGPVTGTDTGTDDGPEETTEERNARFERDALGYLDQMYSAALRMTRNPAD
51 AEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQR
101 SAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKEALQAIPEEFR
151 IAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRG
201 LVPAGAGESNDLKGSGS

>ECFp31672 ECF12 ECF12s1 Arthrobacter sp. UNC362MFTsu5.1

1 MTLVRDSVELLAPLEFSGRGDAAGGQPPVGSGRVTVDLKAMSTIDPAVAA
51 IYEAAGNDAKTNSGRPADAGATAEAAASPDGLASTGGAASPNGVRAAEAE
101 VDVVSETSEERRLRFERDAMQYVDQLYSAAMRMARNPADAEDLVQEAYTK
151 AFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNSDTIEDWQL
201 ARAESHTSSGLRSAEAEALDHLPDSDVKRALQAIPEEFRLAVYFADVEGF
251 AYKEISDIMNTPIGTVMSRLHRGRKMLRDMLADYAAERGFKAATDSGAAA
301 ESTTQENRK

>ECFp31688 ECF12 ECF12s1 Mycobacterium scrofulaceum

1 MSAATSLLDRPMGVEQLACVLAGPVALPVLSGDTAAEGTGVIDMADSDGA
51 TAQEIAEPGPQETDAELMARFERDAIPLLDQLYGGALRMTRNPADAEDLL
101 QETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKRQRQPAEYPTEE
151 ITDWQLASNAEHSSTGLRSAEVEALEALPDNEIKEALQALPEEFRMAVYY
201 ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRSLLADVAKERGFNRGH
251 QAHEEVSS

>ECFp31700 ECF12 ECF12s1 Salinispora pacifica

1 MPVETQAREWDDRDTRRLYRLLEGPNWPAAASAVPVSVGHLGGSESLGER
51 IHVSSARKHPTRGDARLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRN
101 PADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRRRQRQ
151 PIQAPTDEITDWQLAEAESHTSSGLRSAETEALDRLPDSDIKQALQQLPE
201 EFRLAVYLTDVEGFSYKEVAEIMGTPIGTVMSRLHRGRRNLRNLLEQYAA
251 ERGFSSASSAKGSTGRGV

Name Aliases LCA Taxa Group Subgroup
ECFp31718
  • RNA polymerase sigma factor RpoE
  • ECF subfamily RNA polymerase sigma-24 factor
  • ... more
Mycolicibacterium cosmeticum ECF12 ECF12s1

>ECFp31718 ECF12 ECF12s1 Mycolicibacterium cosmeticum

1 MSTACLERPAYLLEPFGRAEREGMGPVTMTDIDEAAPAPTEETDAELTAR
51 FERDAIPLLDQLYGGALRMTRNPADAEDLVQETMVKAYAGFRSFREGTNL
101 KAWLYRILTNTYINNYRKKQRQPSEYPTDEITDWQLASNAEHSSTGLRSA
151 EVEALEALPDSEIKDALQALPEEFRMAVYYADVEGFPYKEIAEIMETPIG
201 TVMSRLHRGRKQLRDLLADVARDRGFMRGGQLASEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31715
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Salinispora arenicola ECF12 ECF12s1

>ECFp31715 ECF12 ECF12s1 Salinispora arenicola

1 MPTDTQARERDDQDVRRLDRLLDGPPWSAVTSAARVSVEHLGGSEFVGER
51 VHVSSAGKHPIRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRN
101 PADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRRRQRQ
151 PIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDIKQALQQLPE
201 EFRLAVYLTDVEGFSYKEVAEIMGTPIGTVMSRLHRGRRNLRKLLEQYAA
251 ERGFTSASSAKGSTGREV

Name Aliases LCA Taxa Group Subgroup
ECFp31755
  • RNA polymerase
  • AS25_09785
  • ... more
Kocuria marina ECF12 ECF12s1

>ECFp31755 ECF12 ECF12s1 Kocuria marina

1 MNDQRTHDSQPVEHPEEVPAGAETTQQRRKRFERDAMQYVDQLYAAALRM
51 ARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKR
101 QREPRQANTDTVEDWQLHRAESHTSTGLRSAEAEALDHLPDSDVKRALQE
151 LPEEFRLAVYFSDVEGFAYKEISEIMDTPIGTVMSRLHRGRKLLREKLGD
201 YAQERGFDTSKVQKKTKDGARAKDRG

Name Aliases LCA Taxa Group Subgroup
ECFp31751
  • RNA polymerase sigma factor RpoE
  • MODMU_RS21690
Modestobacter marinus ECF12 ECF12s1

>ECFp31751 ECF12 ECF12s1 Modestobacter marinus

1 MPVPEETPEARADGSRSAEAESRAQRDARFERDALPYLDQLYPAALRMTR
51 NPSDAEDLVQETFVKAYSAFHQFAEGTNLKAWLYRILTNTYINSYRKKQR
101 QPQQYPTEQVQDWQLYAAEEHTSSGLRSAEIEALDHLPDSDIKEALQQLP
151 EDFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRGLQKLLADYA
201 RERGFVRAGAAEEAHS

>ECFp31805 ECF12 ECF12s1 Salinispora pacifica

1 MPVETQARELDDRETRRRHRVLEGPSWPAVAPADRVSVGHLGGSESVAGV
51 IHVSSARKPPTRGDARLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRN
101 PADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRRRQRQ
151 PIQAPTDEITDWQLAEAESHTSSGLRSAETEALDRLPDSDIKQALQQLPE
201 EFRLAVYLTDVEGFSYKEVAEIMGTPIGTVMSRLHRGRRNLRKLLEQYAA
251 ERGFSSASSAKGSTGRGV

Name Aliases LCA Taxa Group Subgroup
ECFp31806
  • RNA polymerase subunit sigma
  • AA75_RS39875
Kitasatospora sp. MBT63 ECF12 ECF12s1

>ECFp31806 ECF12 ECF12s1 Kitasatospora sp. MBT63

1 MGEDTFRVSADESEEARRERFERDALMYLDPMYSAALRMTRNPADAEDLL
51 QEAFAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQRTAAEE
101 IEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKDALQAIPEEFRIAVYL
151 ADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGLVPAG
201 SGAGQEAKGAGS

Name Aliases LCA Taxa Group Subgroup
ECFp31792
Streptomyces atratus ECF12 ECF12s1

>ECFp31792 ECF12 ECF12s1 Streptomyces atratus

1 MGPVTGTDTGTDDGRAEETTAERNARFERDALGFLDQMYSAALRMTRNPA
51 DAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTFINSYRKKQREPQ
101 RSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKSALQAIPEEF
151 RIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARER
201 GLVPAGAGELDDRKGSGS

>ECFp31821 ECF12 ECF12s1 Cellulosimicrobium funkei

1 MTVLLETPAPAARAASSTPEASTADAAFAAAWSAPVTSPDTQTNRGLGSL
51 LMTERISGSDVSGSPATTSGTTPVEGTTLPTDTDAEDTNRAPQTESDAAR
101 AARFEQDALQYLDQLYSAALRMTRNPSDAEDLVQETFAKAFAAFHQYRPG
151 TNLKAWLYRILTNTFINTYRKKQREPQQAQTDDVEDWQIARAASHTSQGL
201 RSAEAEALDRLPDSDVKRALQELPEDRRMVVYYADVEGFPYKEIAEIMGT
251 PIGTVMSRLHRGRRQLRELLADYAVRRGLVGAKSPGGES

Name Aliases LCA Taxa Group Subgroup
ECFp31848
  • RNA polymerase subunit sigma-70
  • RHA1_RS31005
Rhodococcus ECF12 ECF12s1

>ECFp31848 ECF12 ECF12s1 Rhodococcus

1 MMSSVMEPTSRLQLAVTLTPTATEGISVQEHDRPTADQAEPQDELIARFE
51 RDALPLLDQLYGAALRMTRNPADAEDLVQETYVKAYTAFRSFREGTNLKA
101 WLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHSSTGLRSAEV
151 EALDALPDDDIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTV
201 MSRLHRGRKQLRGLLADVARERGFNRGGTDDVPGDSVVSAEQEVSR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more