ECF proteins of ECF subgroup ECF12s1

Displaying ECF 121 - 140 of 2311 in total

>ECFp31104 ECF12 ECF12s1 Streptomyces

1 MEEVGPVTGTDTGTDDGRAPETPAERNARFERDALGFLDQMYSAALRMTR
51 NPADAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTFINSYRKKQR
101 EPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKSALQAIP
151 EEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYA
201 RERGLVAAGAGDSDDRKGSAS

>ECFp31102 ECF12 ECF12s1 Mycobacterium sp. Soil538

1 MVPASAVEAPLRPVIMLDLLGGAAIEGTVFPRMTDTDGLAAEATLDPDQN
51 PAREESDAELTARFERDAIPMLDQLYGGALRMTRNPADAEDLLQETMVKA
101 YAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLA
151 ANAEHTSTGLRSAEVEALELLPDSEIKEALQALPEDFRMAVYYADVEGFP
201 YKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARERGFIRGQQSDAPEE
251 VTS

>ECFp31138 ECF12 ECF12s1 Microbacterium sp. SUBG005

1 MTALLERDRTATTIPVAVEARDVDWRAMNDTADAGPLDVEPRAQFEEQAL
51 PFMDQLYAAAMRMTRNPADAADLVQETFVKAFGSWATFTQGTNLKAWLYR
101 ILTNTYINTYRKKQREPYQSAIDDLEDWQLGGAESTTASSARSAEAEAID
151 HMPASVVKDALQSIPEDFRMAVYLADVEGFAYQEIADIMKTPIGTVMSRL
201 HRGRRLLRDLLSDYAKERGIQAATGETK

>ECFp31140 ECF12 ECF12s1 Frigoribacterium sp. Leaf164

1 MITPEGDEPTPATSATTAAAVPERAVDAPATDQAAGEGAAAGPAEVEATP
51 PGEAELRSLFEEQALPFMDQLYAAAMRMTRNPADASDLVQETFVKAFAAF
101 RQFQQGTNLKAWLYRIQTNTFINTYRKKQRDPYQGTIDELEDWQMGGAES
151 VTRTSGSTRSAEAEAIDHLPDSAVKDALQKVPEDFRMAVYFADVEGFSYQ
201 EIADIMKTPVGTVMSRLHRGRRLLRGLLADYARDRGIAVPVGTTTKGSKR

Name Aliases LCA Taxa Group Subgroup
ECFp31152
  • RNA polymerase subunit sigma
  • OK074_RS43220
Actinobacteria bacterium OK074 ECF12 ECF12s1

>ECFp31152 ECF12 ECF12s1 Actinobacteria bacterium OK074

1 MGAVTGTDAGTDHGQAEQPEGQGTAGAETTTAASTESTAERSARFERDAL
51 EFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYR
101 ILTNTFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALD
151 HLPDSDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRL
201 HRGRRQLRGMLEDYARDRGLVPAGAGEPNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31153
  • STTU_2025
  • putative RNA polymerase sigma factor RpoE
Streptomyces ECF12 ECF12s1

>ECFp31153 ECF12 ECF12s1 Streptomyces

1 MGATICPSRSGNGLDWSVLHAARTTRNGGVAGVDRKAPEAPGRLFSEAGA
51 RTFADAGTVSEEVGRVTGTDAGEDEAGTRSEESAAERSARFERDALTYLD
101 QMYSAALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTN
151 TFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPD
201 SDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGR
251 RQLRGMLEDYARERGLVPAGAGGSDEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31210
  • RNA polymerase subunit sigma-70
  • ASG04_14915
  • ... more
Curtobacterium sp. Leaf183 ECF12 ECF12s1

>ECFp31210 ECF12 ECF12s1 Curtobacterium sp. Leaf183

1 MTTDEPQATPHDLVDATEEQLDAVSEEAAALEADADVVDATTVSADELRG
51 LFEDQALPFMDQLYGAAMRMTRNPADASDLVQETFVKAFAAFRQFRQGTN
101 LKAWLYRILTNTFINTYRKNQRNPYQGTIDELEDWQLGGAESVTQSISAR
151 SAEADAIDHLPSSAVKDALQAIPEDFRMAVYFADVEGFSYQEIADIMKTP
201 VGTVMSRLHRGRRLLRGLLADHARETGVVPDAASTATMRGRGRGTSAATS
251 RTNGKGTR

Name Aliases LCA Taxa Group Subgroup
ECFp31201
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Gordonia soli NBRC 108243 ECF12 ECF12s1

>ECFp31201 ECF12 ECF12s1 Gordonia soli NBRC 108243

1 MSASTLLASPTDMEIMSGSVDSPDSTGRHPAPGIDSGDVFVTDPRRPRDR
51 VLTGVGRTGIVTEGIVVAESESPDEEPTTTRRKGGRSASGAGSQAPRRAD
101 PTETPEAITERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYVKAFS
151 AFSSFREGTNLKAWLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAAN
201 AEHTSTGLRSAEIEALDALPDDEIKAALQALPEEFRMAVYYADVEGLPYK
251 EIAEIMDTPIGTVMSRLHRGRRQLRDLLADVARERGFNRSSAEKATTESG
301 AAR

>ECFp31226 ECF12 ECF12s1 Paenarthrobacter nicotinovorans

1 MSFRCGGDRTAARRCRSLNGVGFLTLVKDRMVLPEAGYGVQPDSPKLTVD
51 LATMSTIEPAAAAMYEAADATDDDNAPAPAAVDVAAESPEQRRERFERDA
101 MQYVDQLYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLY
151 RILTNTYINLYRKRQREPLQSNSDTIEDWQLAKAESHTSAGLRSAEAEAL
201 DHLPDSDVKNALQAIPEEFRLAVYFADVEGYAYKQISEIMNTPIGTVMSR
251 LHRGRKMLRDMLADYAAERGFKAHTEDQAAAGSNNQEKEK

Name Aliases LCA Taxa Group Subgroup
ECFp31267
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Mobilicoccus pelagius NBRC 104925 ECF12 ECF12s1

>ECFp31267 ECF12 ECF12s1 Mobilicoccus pelagius NBRC 104925

1 MLVQTHPAPPETGFLGLTDAVGTRGFDVGALSWSVMNESSAPPAPRPTPD
51 PLDTAPTRPEQGAATTASGRDGAAARPGADEPGIDVAAETPAERAARFER
101 DAMPYLDQLYSAALRTTRNPSDAEDLVQETYAKAFAAFHQYKPGTNLKAW
151 LYRILTNTYINSYRKKQRQPLQSDAAEVEDYQLARAESHSSTGLRSAEVE
201 ALDHLPDSDVTRALAQLGEDFRLAVYLADVEGFAYKEIAEIMDTPIGTVM
251 SRLHRGRRQLRELLNDYAAERGYSGVK

>ECFp31265 ECF12 ECF12s1 Geodermatophilaceae bacterium URHA0031

1 MDTPAEETAPPVPEETPEARADGSRSAEAESRAQRDARFERDALPYLDQL
51 YPAALRMTRNPSDAEDLVQETFVKAYSAFHQFAEGTNLKAWLYRILTNTY
101 INSYRKKQRQPQQYPTEQVQDWQLYAAEEHTSSGLRSAEIEALDHLPDSD
151 IKEALQQLPEDFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRG
201 LQKLLADYARERGFVRAGAAEEAHS

>ECFp31260 ECF12 ECF12s1 Streptomyces coelicoflavus ZG0656

1 MGSAFCPSRSSRADLDWTVLHAAKTAPIRAAGGPDRRLSSDSSETGLGFT
51 TSLEEVGPVTGTDAGTEHGQAEQPEGRGTGAESTAERSARFERDALEFLD
101 QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTN
151 TFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPD
201 SDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGR
251 RQLRGMLEDYARDRGLVPAGAGESNEAKGSGS

>ECFp31290 ECF12 ECF12s1 Streptomyces sp. NRRL S-475

1 MGPVTGTDAGTDNGQAEQPEGQGGTSTETATERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 QALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARDRGMVPAGAGESNEAKGSGS

>ECFp31313 ECF12 ECF12s1 Rhodococcus hoagii ATCC 33707

1 MLDDHEPANESAGDGPESQDQLIERFERDALPLLDQLYGAALRMTRNPAD
51 AEDLVQETYVKAYSAFRSFKEGTNLKAWLYRILTNTYINSYRKKQRQPAQ
101 YPTDEITDWQLAATAEHSSTGLRSAEVEALDALPDDDIKAALQELPEEFR
151 MAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLRGLLADVARERG
201 FNRGGAVDAAGRSTEVEAEQEVTR

Name Aliases LCA Taxa Group Subgroup
ECFp31321
  • RNA polymerase subunit sigma-24
  • MB27_RS13075
Actinoplanes utahensis ECF12 ECF12s1

>ECFp31321 ECF12 ECF12s1 Actinoplanes utahensis

1 MRAGTECAKRDGRAANRVRSLLSSPEWPTATAAPVQPTVSVSTPVVFKGV
51 TGALPVSSAGRSRGESRVAQKERTEERRERFEREALPFVDQLYAAGLRMT
101 RNPADAEDLVQETFLKAFSAFHQFEQGTNLKAWLYRILTNTYINSYRRKQ
151 RQPVQAPTEEITDWQLASSESHTSQGLRSAETEALDRLPDSDIKEALQSL
201 PEDFRLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLRNLLEGY
251 AADRGITRTATSEPQGA

Name Aliases LCA Taxa Group Subgroup
ECFp31362
  • hypothetical protein
  • UM93_RS07385
Psychromicrobium lacuslunae ECF12 ECF12s1

>ECFp31362 ECF12 ECF12s1 Psychromicrobium lacuslunae

1 MLLEPARETEKSANSAVDLRLRLDLGAMNSVDSTESVDQTPAPAEETVDL
51 AAESIEERRARFERDAMQYVDQLYSAAMRMARNPADAEDLVQEAYTKAFS
101 AFHQYRPGTNLKAWLYRILTNTYINLYRKRQREPLPSGSDQVEDWQLARA
151 ESHTSSGLRSAESEALDHLPDSDVKNALQSIPEEFRLAVYFADVEGYAYK
201 EISDIMNTPIGTVMSRLHRGRKMLRDLLSEYAAERGFRAADNGGESLLKE
251 DMRSTK

>ECFp31405 ECF12 ECF12s1 Streptomyces rimosus subsp. rimosus

1 MEEVGPVTGTDAGTDGTAEEHAGSGTRETDAERNARFERDALTFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 AALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGAATAQSSQPDDRKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31414
  • RNA polymerase sigma factor RpoE
  • IF55_RS20075
Streptomyces varsoviensis ECF12 ECF12s1

>ECFp31414 ECF12 ECF12s1 Streptomyces varsoviensis

1 MGPVTGTDAGTDDGQAREPATPAESALERNARFERDALTFLDQMYSAALR
51 MTRNPADAEDLVQETYAKAYASFHQFRDGTNLKAWLYRILTNTFINSYRK
101 KQREPLRSGSEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQ
151 AIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLE
201 DYARERGLVPAGAATASNASDESHDGKGSDS

>ECFp31427 ECF12 ECF12s1 Mycobacterium avium subsp. hominissuis TH135

1 MTSPEVPEAHAEPAAHEETREELHEEAREETDAELTARFERDAIPLLDQL
51 YGGALRMTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTY
101 INSYRKKQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALESLPDSE
151 IKDALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQ
201 LRGLLADVAKERGFNRGQQTHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31419
Arthrobacter alpinus ECF12 ECF12s1

>ECFp31419 ECF12 ECF12s1 Arthrobacter alpinus

1 MQTLSHAAPSAAPLKLSLSIDSTVMNISEPEQTATSAEAAPVVAAVTDVA
51 DVDVANETPEAKRARFERDAMVYVDQLYSAAMRMARNPSDAEDLVQEAYT
101 KAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNADSIEDWQ
151 LARAESHTSSGLRSAEADALDHLPDSDVKSALQAIPEEFRLAVYFADVEG
201 FAYKEISEIMNTPIGTVMSRLHRGRKLLRDMLADYAVDRGYIKETNHLTE
251 TEK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more