ECF proteins of ECF subgroup ECF12s1

Displaying ECF 81 - 100 of 2311 in total

>ECFp30870 ECF12 ECF12s1 Nocardia mexicana NBRC 108244

1 MGVTSDDNEREDIGTPDDLAVDDDGQPGVARSTASDTELAQRFERDALPL
51 LDQLYGAALRMTRNPADAEDLVQETFAKAYQGFRSFREGTNLRAWLYRIL
101 TNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEMEALEAL
151 PDDDIKAALQSLPEEFRMAVYYADVEGFPYKEIADIMGTPIGTVMSRLHR
201 GRKQLKGLLADVAHERGFDRNRTGSAGRQEVTQ

>ECFp30823 ECF12 ECF12s1 Nocardia farcinica IFM 10152

1 MSDAGTTDAETAGTPVDEAELAQRFERDALPLLDQLYGAALRMTRNPADA
51 EDLVQETYVKAFQGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQY
101 PTDEITDWQLAATAEHTSTGLRSAEVEALDALPDDDIKAALQELPEEFRM
151 AVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLKGLLADVARERGF
201 NRSERQEVKQ

>ECFp30788 ECF12 ECF12s1 Nocardia kruczakiae NBRC 101016

1 MDDDTASEDAEARDAEDTEIDGDSTVRSTADEAELARRFERDALPLLDQL
51 YGAALRMTRNPADAEDLVQETFAKAYQGFRSFREGTNLRAWLYRILTNTY
101 INSYRKKQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEMEALEALPDDD
151 IKAALQSLPEEFRMAVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQ
201 LKGLLADVAHERGFDRNRTGNGARQEVTQ

>ECFp30753 ECF12 ECF12s1 Nocardia miyunensis NBRC 108239

1 MGVTSDDDLAADRLDGAAETRKSGGDAEARESAASADPAELAQRFERDAL
51 PLLDQLYGAALRMTRNPADAEDLVQETFAKAYQGFRSFREGTNLRAWLYR
101 ILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEMEALE
151 ALPDDDIKAALQELPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRL
201 HRGRKQLKGLLADVAHERGFDRNQAGDGARQEVTQ

>ECFp30729 ECF12 ECF12s1 Nocardia asiatica NBRC 100129

1 MTSDDDVVADDVAAVDDAELAQRFERDALPLLDQLYGAALRMTRNPADAE
51 DLVQETYVKAYQGFKSFREGTNLRAWLYRILTNTYINSYRKKQRQPAQYP
101 TDEITDWQLAATAEHTSQGLRSAEVEALDALPDDDIKAALQELPEEFRMA
151 VYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLADVARERGFN
201 RSGERQEVKQ

>ECFp30680 ECF12 ECF12s1 Millisia brevis NBRC 105863

1 MARRFETEALPLLDQLYGAALRMTRNPADAEDLVQETYAKAFSAFGSFRQ
51 GTNVRAWLYRILTNTYINSYRKRQRQPAQYPTDEITDRQLAATAEHTSSG
101 LRSAEVEALDALPDDAIKSALQELPEDFRMAVYYADVEGFPYREIAEIMG
151 TPIGTVMSRLHRGRRQLRGLLADVARERGFTRTSTDRDRADAVTSEVTP

>ECFp30474 ECF12 ECF12s1 Nocardia anaemiae NBRC 100462

1 MTSDDDVVTDGAVGAAVDDAELVQRFERDALPLLDQLYGAALRMTRNPAD
51 AEDLVQETYVKAFQGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQ
101 YPTDEITDWQLAATAEHTSTGLRSAEVEALDALPDDDIKAALQELPEEFR
151 MAVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLADVARERG
201 FNRNGAERQEVKQ

Name Aliases LCA Taxa Group Subgroup
ECFp30473
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Nocardia asteroides ECF12 ECF12s1

>ECFp30473 ECF12 ECF12s1 Nocardia asteroides

1 MTVLLEERPVSPRGARLPFESVVPVDSATTAIEGIGVTSDDDVVPTEASG
51 SAVDDAELAARFERDALPMLDQLYGAALRMTRNPADAEDLVQETYVKAFQ
101 GFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAAT
151 AEHSSTGLRSAEVEALDALPDDEIKAALQQLPEEFRMAVYYADVEGFPYK
201 EIADIMGTPIGTVMSRLHRGRKQLKGLLADVARDRGFDRGERQEVSK

>ECFp30359 ECF12 ECF12s1 Nocardia gamkensis NBRC 108242

1 MTSDDDVAADDVGAVDDAELAQRFERDALPLLDQLYGAALRMTRNPADAE
51 DLVQETYVKAYQGFKSFREGTNLRAWLYRILTNTYINSYRKKQRQPAQYP
101 TDEITDWQLAATAEHTSQGLRSAEVEALDALPDDDIKAALQELPEEFRMA
151 VYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLKGLLADVARERGFN
201 RSGERQEVKQ

Name Aliases LCA Taxa Group Subgroup
ECFp30272
Nocardia seriolae ECF12 ECF12s1

>ECFp30272 ECF12 ECF12s1 Nocardia seriolae

1 MDAGEDQAVDYDEVGESGARSTESAAELAARFERDALPLLDQLYGAALRM
51 TRNPADAEDLVQETFAKAYQGFKSFREGTNLRAWLYRILTNTYINSYRKK
101 QRQPAQYPTDEITDWQLASTAEHTSTGLRSAEMEALEALPDDDIKAALQE
151 LPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLKGLLAD
201 VARERGFNRSGNDAAREEVTQ

>ECFp31905 ECF12 ECF12s1 Mycobacterium xenopi 3993

1 MTARFERDAIPLLDQLYGGALRLTRNPADAEDLLQETMVKAYAGFRSFRE
51 GTNLKAWLYRILTNTYINNYRRKQRQPSQYPTEEITDWQLAANAEHSSTG
101 LRSAEVEALEALPDTEIKEALQALPEEFRMAVYLADVEGFPYKEIAEIMD
151 TPIGTVMSRLHRGRRQLRGLLANVAKERGFIRGDQTAEEVSS

>ECFp31888 ECF12 ECF12s1 Mycobacterium sp. 1274756.6

1 MADIDGADSAPSETSPDTGFAAHDEEDTNRAPDETDEELTARFERDAIPL
51 LDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRIL
101 TNTYINSYRKKQRQPAEYPAEEITDWQIASAAQHSSRGLRSAEIEALEAL
151 PDTEIKAALQALPEDFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHR
201 GRRQLRNLLTDVAKDRGFLRGDRAAEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31358
  • RNA polymerase subunit sigma
  • AO501_13690
  • ... more
Mycobacterium gordonae ECF12 ECF12s1

>ECFp31358 ECF12 ECF12s1 Mycobacterium gordonae

1 MSTATSLLGAERLDRFLASPAAWFARPGDTATEGTVLIKMADIDGETGLD
51 GATNGPPKPDETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQ
101 ETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPSEYPTEEI
151 TDWQLAANAEHTSTGLRSAEVEALESLPDTEIKEALQALPEEFRMAVYYA
201 DVEGFPYKEIAEIMGTPIGTVMSRLHRGRRQLRELLADVAKDRGFTRGEQ
251 AHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30188
Mycobacterium celatum ECF12 ECF12s1

>ECFp30188 ECF12 ECF12s1 Mycobacterium celatum

1 MCLLEGPVLVPGLSGDAPTEGTVLTKMADSDAATGPEAPAPDPMEETDEQ
51 LTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFTP
101 GTNLKAWLYRILTNTYINNYRKKQRQPAQYPTDEITDWQLAATAEHSSTG
151 LRSAEVEALESLPDTEIKEALQALPEDFRMAVYYADVEGFPYKEIAEIMD
201 TPIGTVMSRLHRGRRQLRGLLADVAKERGFLRGDQAPEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30179
Mycobacterium szulgai ECF12 ECF12s1

>ECFp30179 ECF12 ECF12s1 Mycobacterium szulgai

1 MSTATSLLGEQRLTSYDPATEGTVLIKMADIDGVTEVEVAEPRPPETDAE
51 LTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRE
101 GTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLASNAEHSSTG
151 LRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMD
201 TPIGTVMSRLHRGRRQLRGLLSDVAKDRGFVRGEQAHEEVSS

>ECFp30141 ECF12 ECF12s1 Mycobacterium asiaticum

1 MSTATSLLGAEWLDRDTAIEGTVLIEMADIDGVAGSEVVEARPPETDAEL
51 TARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREG
101 TNLKAWLYRILTNTYINSYRKKQRQPSEYPTEEITDWQLAANAEHSSTGL
151 RSAEVEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMGT
201 PIGTVMSRLHRGRRQLRDLLADVAKDRGFARGQQAHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30789
  • RNA polymerase sigma factor RpoE
  • B842_02880
Corynebacterium humireducens NBRC 106098 = DSM 45392 ECF12 ECF12s1

>ECFp30789 ECF12 ECF12s1 Corynebacterium humireducens NBRC 106098 = DSM 45392

1 MGTQGTELANRFEEEALPLLDQLYGGALRMTRNPTDAEDLVQETYLKAFR
51 AFDSFKPGTNLKAWLYRIMTNTYINVYRKRQRQPVQAPAEEISDWQLYTT
101 SSHDSTGLESAEVEALKNMPDGKIAEAMNQLSEDYRMVVYYADVEGLAYK
151 EIAEIMDTPIGTVMSRLHRGRKQLRQLLKEVAHAQGIGLDHPDMDITTPE
201 ASK

Name Aliases LCA Taxa Group Subgroup
ECFp30521
  • hypothetical protein
  • ASF50_06385
  • ... more
Nocardioides sp. Leaf307 ECF12 ECF12s1

>ECFp30521 ECF12 ECF12s1 Nocardioides sp. Leaf307

1 MTDTFESPADAPVDLATETETERSARFERDALPFLDQLYSAAMRMTRNPA
51 DAEDLVQETFAKAYSSFHQFKPGTNLKAWLYRILTNTFINTYRKKQRQPQ
101 QSMSEDVEDWQLARAESHSSTGLKSAETEALEHLPDSQVKDALQRLPEEF
151 RLAVYLADVEGFAYKEIAEIMETPIGTVMSRLHRGRRQLRDMLTDYARSR
201 DLTAAARLEGEKA

>ECFp30519 ECF12 ECF12s1 Nocardioides jensenii JCM 1364 = NBRC 14755

1 MTESLTTDVDMTEVDIANETDVERSMRFERDAMPFLDQLYSAAMRMTRNP
51 ADAEDLVQETFAKAFSAFHQYKPGTNLKAWLYRILTNTFINTYRKKQRQP
101 QQSMAEDVEDWQLARAESHSSTGLKSAEMEALEHLPDSQVKDALQRLPEE
151 FRLAVYLADVEGFPYKEIAEIMETPIGTVMSRLHRGRRQLRDMLSGYVRD
201 NYLIKSAPEGDE

Name Aliases LCA Taxa Group Subgroup
ECFp178817
Marmoricola scoriae ECF12 ECF12s1

>ECFp178817 ECF12 ECF12s1 Marmoricola scoriae

1 MLQALEWPDLERSVEPSPFRAVPVGWNAMTTPETTPSSLVDLDEAPEPVD
51 VATESEAARQLRFETDALPFLDQLYSAAMRMTRNPADAEDLVQETFAKAY
101 GNFHQFRPGTNLKAWLYRILTNTFINTYRKKQRQPQQSMTEDVEDWQLAR
151 AESHSSSGLKSAEMEALEHLPDSDVKTALQNLPEDFRLAVYLADVEGFPY
201 KEIAEIMQTPIGTVMSRLHRGRRQLRQMLTEYVRENDLLPDATVDAKVEA
251 TGGAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more