ECF proteins of ECF subgroup ECF12s1

Displaying ECF 41 - 60 of 2311 in total

>ECFp178768 ECF12 ECF12s1 Arthrobacter sp. ok362

1 MTQVLDRTEPEADSGQSWTLALPAVLGARRKVTVDLNAMSTMDPAVAAMH
51 EVAGNDATPTKTPDAGTSGAPERPAVHMPADGPAALETEVDGRPLDVSTE
101 SAEERRVRFERDAMQYVDQLYSAAMRMARNPSDAEDLVQEAYTKAFSAFH
151 QYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNSDTIEDWQLARAESH
201 TSSGLRSAEAEALDHLPDSDVKRALQAIPEEFRLAVYFADVEGFAYKEIS
251 DIMNTPIGTVMSRLHRGRKMLRDMLADYAAERGFGAAIESSAAADSNKQE
301 NRK

>ECFp31391 ECF12 ECF12s1 Streptomyces griseoplanus

1 MGEETFRASVEESEDTRRERFERDALGYLDQMYSAALRMTRNPADAEDLL
51 QETFAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQRTGAEE
101 IEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKEALQAIPEEFRIAVYL
151 ADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLEDYARDRGLVPAG
201 SGAGAGDEGKGSST

>ECFp31293 ECF12 ECF12s1 Streptomyces sp. NRRL S-350

1 MGPVVGTEHEAEPGRGPDEVRPAGEALTGEELAEAIGEDTYRVSAEEGEE
51 ARRERFERDALGFLDPMYSAALRMTRNPADAEDLLQEAFAKAYASFHQFR
101 EGTNLKAWLYRILTNTFINSYRKKQREPQRTAAEEIEDWQLARAESHMST
151 GLRSAETQALDHLPDSDVKDALQAIPEEFRIAVYLADVEGFAYKEIADIM
201 GTPIGTVMSRLHRGRRQLRGMLEDYARERGLVPAGSGAGQEAKGSGS

>ECFp178811 ECF12 ECF12s1 Streptomyces sp. CB02056

1 MGSIACPERPEEREATAAFAPSWSDWIDAGEKPVSPISSISGRPAVGRAR
51 HAEEVGPVVGTEHEADPGRGPGDALPAGEALTGEELAEAIGEDTYRVSAE
101 ESEEARRERFERDALGYLDPMYSAALRMTRNPADAEDLLQEAFAKAYASF
151 HQFREGTNLKAWLYRILTNTFINSYRKKQREPQRTAAEEIEDWQLARAES
201 HMSTGLRSAETQALDHLPDSDVKDALQAIPEEFRIAVYLADVEGFAYKEI
251 ADIMGTPIGTVMSRLHRGRRQLRGMLEDYARERGLVPAGSGAGQEAKGSG
301 S

>ECFp31087 ECF12 ECF12s1 Clavibacter nebraskensis NCPPB 2581

1 MVHSTEEAADHAEAERAEVEEPRKAQPGDNRELFEEQALPFIDQLYAAGL
51 RMTRNPADAQDLVQETFVKAYTAFHQFKQGTNLKAWLYRILTNTFINNYR
101 KKQRDPYNGTIDELEDWQLGGATSATATTTRSAEAEAIDHLPDSTVKDAL
151 QSIPEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRMLRSLL
201 SDYARERGISTAHLTGATK

>ECFp30604 ECF12 ECF12s1 Rathayibacter sp. Leaf299

1 MEETVEESLDDAATVEPDAPVDLRALFEQQALPFIDQLYAAGLRMTKNPA
51 DAQDLVQETFAKAFGAFRQFEQGTNLKAWLYRILTNTFINSYRKKQREPY
101 QSAIDELEDWQLGGAESTTATSSRSAEAEAIDHLPDTAVKEALQAIPEDF
151 RLAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRMLRERLTDYARER
201 GFRAAFTSGSTK

Name Aliases LCA Taxa Group Subgroup
ECFp30145
  • hypothetical protein
  • sigma-70 region 2 domain-containing protein
  • ... more
Nocardioides sp. CF8 ECF12 ECF12s1

>ECFp30145 ECF12 ECF12s1 Nocardioides sp. CF8

1 MGDAEAAVVWKTMTESLSETSAADDLLATETAEERSARFERDALPFLDQL
51 YGAAMRMTRNPADAEDLVQETFAKAYSAFHQFKPGTNLKAWLYRILTNTY
101 INTYRKKQRQPQQSMAEDVEDWQLARAESHTSTGLKSAEMEALEHLPDSE
151 VKDALQRLPEEFRLAVYLADVEGFPYKEIAEIMNTPIGTVMSRLHRGRRQ
201 LRDMLSHHVRANDLLPSGATEAK

Name Aliases LCA Taxa Group Subgroup
ECFp31173
  • hypothetical protein
  • L979_RS00850
Kocuria sp. ZOR0020 ECF12 ECF12s1

>ECFp31173 ECF12 ECF12s1 Kocuria sp. ZOR0020

1 MNDDDATRQPSTPQPFGRPTDHQETALGTHDPADQDDHVLDTEMDEDAAE
51 DSGEEFVDVANETPAQRAVRFEREAMVYIDQLYAAALRMARNPADAEDLV
101 QEAYTKAFSSYHQYRPGTNLKAWLYRILTNTYINLYRKRQREPQQSNTDT
151 VEDWQLHRAEQHSSTGLRSAEVEALDHLPDSDVKRALQDLPEEFRLAIYL
201 SDVEGFAYKEIAEIMATPIGTVMSRLHRGRKLLREKLADYATDRGIDTTG
251 TGRRKTSTTQSATTDAKAAATAAAAGETPNRSSRATHSTHQEG

Name Aliases LCA Taxa Group Subgroup
ECFp140354
Micrococcus terreus ECF12 ECF12s1

>ECFp140354 ECF12 ECF12s1 Micrococcus terreus

1 METQNATGDPVTHDLPGVDVQSESEAQRRARFERDAMEYVDQLYSAAMRM
51 TRNPQDAEDLVQEAYTKAYSSFHQYKPGTNLKAWLYRILTNTYINLYRKR
101 QRQPQQSTMDTLEDWQMAQAAEHTSTGLRSAETEALDRLPDSDVKEALQS
151 IPEEFRLAVYFADVEGFAYREIAEILDIPIGTVMSRLHRGRKLLRELLTD
201 YARERGMDVEKAARRSAAKKTKTTPNTAPAGQEADQ

Name Aliases LCA Taxa Group Subgroup
ECFp140283
Kocuria salsicia ECF12 ECF12s1

>ECFp140283 ECF12 ECF12s1 Kocuria salsicia

1 MNDQRSQDSRAVDHPEEVPAGEESTQQRRERFERDAMQYVDQLYAAALRM
51 ARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKR
101 QREPRQANTDAVEDWQLHRAESHTSTGLRSAEVEALDHLPDSDVKRALQE
151 LPEEFRLAVYFSDVEGFAYKEISEIMDTPIGTVMSRLHRGRKLLREKLGD
201 YAQERGFDTSRARKGKDGAPAKDRG

Name Aliases LCA Taxa Group Subgroup
ECFp31661
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-E factor
  • ... more
Tetrasphaera jenkinsii Ben 74 ECF12 ECF12s1

>ECFp31661 ECF12 ECF12s1 Tetrasphaera jenkinsii Ben 74

1 MTATPPTDDLLAADPAPFDDVDVSSETPAERQARFEALALPLLDQLYSAA
51 LRTTRNPADAEDLVQETYAKAFAAFHQFRPGTNLKAWMYRILTNTYINSY
101 RKKQREPLQSDAAEIEDYQLAAAESHTSKGLRSAEVEALDHLPDSEVKRA
151 LQELPEEFRLAVYFADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLREL
201 LSSYAADRGFRVEEES

>ECFp31021 ECF12 ECF12s1 Janibacter limosus NBRC 16128

1 MTDPTTDELAAQAAADAAVDVSDETTEQRRARFEREAMPLLDQLYSAALR
51 TTRNPTDAEDLVQETYAKAFAAFHQYRPGTNLKAWMYRILTNTYINTYRK
101 KQREPKQSDSPEVEDYQLHKAEQHTSKGLRSAEVEALDRMPDSEVKRALQ
151 ELPEDFRMAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLREMLT
201 DYAADRGMAVAKESKA

Name Aliases LCA Taxa Group Subgroup
ECFp30854
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma-24
  • ... more
Knoellia flava TL1 ECF12 ECF12s1

>ECFp30854 ECF12 ECF12s1 Knoellia flava TL1

1 MTTPQTTSDDMTVDVATETPAERQARFEAEALPLLDQLYAAALRTTRNPA
51 DAEDLLQETYAKAFAAFHQYKPGTNLRAWMYRILTNTYINTYRKKQREPQ
101 QSDAADVEDYQLVRAESHTSSGLKSAEAEALDHLPDSEIKRALQDLPEDF
151 RMAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLREMLTEYAAER
201 GFGKEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30115
  • RNA polymerase sigma factor RpoE
  • JNB_RS07075
Janibacter sp. HTCC2649 ECF12 ECF12s1

>ECFp30115 ECF12 ECF12s1 Janibacter sp. HTCC2649

1 MTTPQTTSDEPTVDVTTETPDERQARFEAEALPLLDQLYAAAMRTTRNPA
51 DAEDLLQETYAKAFAAFHQYKPGTNLRAWMYRILTNTYINTYRKKQREPL
101 QSDASEVEDYQLARAESHTSSGLKSAEAQALDHLPDSEIKRALQDLPEDF
151 RMAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLREMLTEYAAER
201 GFGKEVSS

>ECFp30448 ECF12 ECF12s1 Frigoribacterium

1 MSTPEGHEPTPTDAAVEPTEADVDAALEAVDADAVKRALFEEQALPFMDQ
51 LYAAGMRMTRNPADASDLVQETFVKAYAAFAQFQQGTNLKAWLYRIQTNT
101 FINTYRKKQRDPYQGTIDELEDWQMGGAESATRASGSTRSAEAEAIDHLP
151 DSAVKDALQKVPEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRG
201 RRLLRELLADYARDRGIAVPVGPSKGAKK

>ECFp140406 ECF12 ECF12s1 Curtobacterium sp. MCBA15_009

1 MAEEQAAAEPVDAKTVSESELRSLFEDQALPFMDQLYGAAMRMTRNPADA
51 SDLVQETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQRNPYQG
101 TIDELEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQSIPEDFR
151 MAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETG
201 IVPDAASTATMRGRGRKTAAAEGRVEGKEAR

>ECFp140403 ECF12 ECF12s1 Curtobacterium sp. MMLR14_010

1 MDAVEDEDELVDAKTVSSPELRRLFEDQAIPFMDQLYGAAMRMTRNPADA
51 SDLVQETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQRNPYQG
101 TIDELEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQAIPEDFR
151 MAVYFADVEGFSYQEIAEIMKTPVGTVMSRLHRGRRLLRGLLADHARETG
201 VVPDAASTATMRGRGRGTAAASSRTNGKGAR

>ECFp140238 ECF12 ECF12s1 Curtobacterium sp. MCBA15_016

1 MTTDEPHAAPHDLVEETEAQLDAVSEEAALREDEAGDREDEASDREDEAS
51 DREDEASDDQATAVDVVDAKTVSEAELRSLFEDQALPFMDQLYGAAMRMT
101 RNPADASDLVQETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQ
151 RNPYQGTIDELEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQA
201 IPEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLAD
251 HARETGIVPDAASTATMRGRGRKVAAASSRVEGKEAR

>ECFp140225 ECF12 ECF12s1 Curtobacterium sp. MCBA15_013

1 MREDEAGDREDEASDREDEASDDEAGDDEATAVDVVDAKTVSEAELRSLF
51 EDQALPFMDQLYGAAMRMTRNPADASDLVQETFVKAFAAFRQFKQGTNLK
101 AWLYRILTNTFINTYRKNQRNPYQGTIDELEDWQLGGAESVTQSISARSA
151 EADAIDHLPSSAVKDALQAIPEDFRMAVYFADVEGFSYQEIADIMKTPVG
201 TVMSRLHRGRRLLRGLLADHARETGIVPDAASTATMRGRGRKVAAASSRV
251 EGKEAR

>ECFp140224 ECF12 ECF12s1 Curtobacterium sp. MCBA15_005

1 MLTAVPTTLGTLGLDLAAMTTDEPQAAPHHLVDETEVQLDAVEEEREALD
51 DAADEPVDAKTVSEGELRSLFEDQALPFMDQLYGAAMRMTRNPADASDLV
101 QETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQRNPYQGTIDE
151 LEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQAIPEDFRMAVY
201 FADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETGIVPD
251 AASTATMRGRGRGAAQTTKATAATGRTGRKDAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more